RegulonDB RegulonDB 10.8: Gene Form
   

ybgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dtpD phr ybfD ybgA LexA LexA terminator phrp phrp ybgAp1 ybgAp1 ybgAp2 ybgAp2

Gene      
Name: ybgA    Texpresso search in the literature
Synonym(s): ECK0696, EG11108, b0707, tkp
Genome position(nucleotides): 739001 --> 739510 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.39
External database links:  
ASAP:
ABE-0002414
ECHOBASE:
EB1099
OU-MICROARRAY:
b0707
PortEco:
ybgA
STRING:
511145.b0707
COLOMBOS: ybgA


Shine dalgarno      
Sequence: taaaccgctcAGGAGCagtaATG


Product      
Name: DUF1722 domain-containing protein YbgA
Synonym(s): Tkp, YbgA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.211
Isoelectric point: 9.794
Motif(s):
 
Type Positions Sequence
41 -> 158 KLVFLAHSQPEYRKLGPFVADIHQWQNLDDYYNQYRQRVVVLLSHPANPRDHTNVLMHVQGYFRPHIDSTERQQLAALIDSYRRGEQPLLAPLMRIKHYMALYPDAWLSGQRYFELWP

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11108-MONOMER
ECOLIWIKI:
b0707
INTERPRO:
IPR013560
PFAM:
PF08349
PRIDE:
P24252
REFSEQ:
NP_415235
UNIPROT:
P24252


Operon      
Name: ybgA-phr         
Operon arrangement:
Transcription unit        Promoter
ybgA-phr
ybgA-phr
phr


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB