RegulonDB RegulonDB 10.8: Gene Form
   

yccA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yccA tusE serT yccX CpxR anti-anti-terminator anti-terminator terminator terminator TSS_1307 TSS_1307 TSS_1306 TSS_1306 TSS_1305 (cluster) TSS_1305 (cluster) yccAp yccAp TSS_1304 (cluster) TSS_1304 (cluster) TSS_1303 TSS_1303 TSS_1302 TSS_1302 TSS_1301 (cluster) TSS_1301 (cluster) TSS_1300 TSS_1300 TSS_1299 TSS_1299 TSS_1298 TSS_1298 TSS_1297 TSS_1297 TSS_1296 TSS_1296 TSS_1295 (cluster) TSS_1295 (cluster)

Gene      
Name: yccA    Texpresso search in the literature
Synonym(s): ECK0961, EG11113, b0970
Genome position(nucleotides): 1030759 <-- 1031418 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.21
External database links:  
ASAP:
ABE-0003280
ECHOBASE:
EB1104
OU-MICROARRAY:
b0970
PortEco:
yccA
STRING:
511145.b0970
COLOMBOS: yccA


Product      
Name: modulator of FtsH protease
Synonym(s): YccA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 23.363
Isoelectric point: 9.019
Motif(s):
 
Type Positions Sequence
47 -> 64 LPSPGLILTLVGMYGLMF
133 -> 153 FLGGMLMAGIVVVLIGMVANI
19 -> 213 KVLRNTYFLLSLTLAFSAITATASTVLMLPSPGLILTLVGMYGLMFLTYKTANKPTGIISAFAFTGFLGYILGPILNTYLSAGMGDVIAMALGGTALVFFCCSAYVLTTRKDMSFLGGMLMAGIVVVLIGMVANIFLQLPALHLAISAVFILISSGAILFETSNIIHGGETNYIRATVSLYVSLYNIFVSLLSIL
74 -> 94 TGIISAFAFTGFLGYILGPIL
196 -> 216 VSLYVSLYNIFVSLLSILGFA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.6 - turnover, degradation
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0043066 - negative regulation of apoptotic process
GO:0030162 - regulation of proteolysis
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Chae HJ., et al., 2003
[2] Kihara A., et al., 1998
[3] Schumann W. 1999
[4] Shimohata N., et al., 2002
External database links:  
DIP:
DIP-47918N
ECOCYC:
EG11113-MONOMER
ECOLIWIKI:
b0970
INTERPRO:
IPR006214
INTERPRO:
IPR006213
MINT:
MINT-1274885
PANTHER:
PTHR23291
PFAM:
PF01027
PRIDE:
P0AAC6
PROSITE:
PS01243
REFSEQ:
NP_415490
SMR:
P0AAC6
UNIPROT:
P0AAC6


Operon      
Name: yccA         
Operon arrangement:
Transcription unit        Promoter
yccA


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1295 (cluster) 1030888 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1296 1030891 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1297 1031154 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1298 1031167 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1299 1031229 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1300 1031236 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1301 (cluster) 1031262 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1302 1031273 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1303 1031275 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1304 (cluster) 1031345 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1305 (cluster) 1031450 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1306 1031454 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1307 1031546 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chae HJ., Ke N., Kim HR., Chen S., Godzik A., Dickman M., Reed JC., 2003, Evolutionarily conserved cytoprotection provided by Bax Inhibitor-1 homologs from animals, plants, and yeast., Gene 323:101-13

 [2] Kihara A., Akiyama Y., Ito K., 1998, Different pathways for protein degradation by the FtsH/HflKC membrane-embedded protease complex: an implication from the interference by a mutant form of a new substrate protein, YccA., J Mol Biol 279(1):175-88

 [3] Schumann W., 1999, FtsH--a single-chain charonin?, FEMS Microbiol Rev 23(1):1-11

 [4] Shimohata N., Chiba S., Saikawa N., Ito K., Akiyama Y., 2002, The Cpx stress response system of Escherichia coli senses plasma membrane proteins and controls HtpX, a membrane protease with a cytosolic active site., Genes Cells 7(7):653-62

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB