RegulonDB RegulonDB 10.8: Gene Form
   

rluC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rluC yceF yceQ sraB Cis-reg TSS_1365 TSS_1365 psrDp psrDp rnep3 rnep3 rnep2 rnep2 rnep1 rnep1 TSS_1364 (cluster) TSS_1364 (cluster)

Gene      
Name: rluC    Texpresso search in the literature
Synonym(s): ECK1071, EG11118, b1086, yceC
Genome position(nucleotides): 1144940 --> 1145899 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.46
External database links:  
ASAP:
ABE-0003675
ECHOBASE:
EB1108
OU-MICROARRAY:
b1086
PortEco:
rluC
STRING:
511145.b1086
COLOMBOS: rluC


Product      
Name: 23S rRNA pseudouridine955/2504/2580 synthase
Synonym(s): RluC, YceC, ribosomal large subunit (23S rRNA) pseudouridine synthase C, ribosomal large subunit pseudouridine synthase C
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.027
Isoelectric point: 10.452
Motif(s):
 
Type Positions Sequence
20 -> 66 QRIDNFLRTQLKGVPKSMIYRILRKGEVRVNKKRIKPEYKLEAGDEV
101 -> 249 HILVLNKPSGTAVHGGSGLSFGVIEGLRALRPEARFLELVHRLDRDTSGVLLVAKKRSALRSLHEQLREKGMQKDYLALVRGQWQSHVKSVQAPLLKNILQSGERIVRVSQEGKPSETRFKVEERYAFATLVRCSPVTGRTHQIRVHTQ

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0120159 - rRNA pseudouridine synthase activity
GO:0016853 - isomerase activity
GO:0003723 - RNA binding
GO:0009982 - pseudouridine synthase activity
biological_process GO:0009451 - RNA modification
GO:0001522 - pseudouridine synthesis
GO:0006364 - rRNA processing
GO:0000455 - enzyme-directed rRNA pseudouridine synthesis
Note(s): Note(s): ...[more].
Reference(s): [1] Gustafsson C., et al., 1996
External database links:  
DIP:
DIP-47832N
ECOCYC:
EG11118-MONOMER
ECOLIWIKI:
b1086
INTERPRO:
IPR020103
INTERPRO:
IPR006224
INTERPRO:
IPR006225
INTERPRO:
IPR036986
INTERPRO:
IPR002942
INTERPRO:
IPR006145
MODBASE:
P0AA39
PDB:
1V9K
PDB:
1XPI
PFAM:
PF00849
PFAM:
PF01479
PRIDE:
P0AA39
PRODB:
PRO_000023778
PROSITE:
PS01129
PROSITE:
PS50889
REFSEQ:
NP_415604
SMART:
SM00363
SMR:
P0AA39
UNIPROT:
P0AA39


Operon      
Name: rluC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1364 (cluster) 1144680 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1365 1146590 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gustafsson C., Reid R., Greene PJ., Santi DV., 1996, Identification of new RNA modifying enzymes by iterative genome search using known modifying enzymes as probes., Nucleic Acids Res 24(19):3756-62

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB