RegulonDB RegulonDB 10.7: Gene Form
   

yciA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tonB yciB yciA terminator yciAp8 yciAp8

Gene      
Name: yciA    Texpresso search in the literature
Synonym(s): ECK1247, EG11121, b1253
Genome position(nucleotides): 1311848 <-- 1312246 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.37
External database links:  
ASAP:
ABE-0004198
ECHOBASE:
EB1111
OU-MICROARRAY:
b1253
PORTECO:
yciA
REGULONDB:
b1253
STRING:
511145.b1253
M3D: yciA
COLOMBOS: yciA
PortEco: b1253


Product      
Name: acyl-CoA thioesterase YciA
Synonym(s): YciA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 14.231
Isoelectric point: 8.053
Motif(s):
 
Type Positions Sequence
26 -> 97 NGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYARCVQKGTTSVSINIEVWVK
8 -> 123 PQGDLVLRTLAMPADTNANGDIFGGWLMSQMDIGGAILAKEIAHGRVVTVRVEGMTFLRPVAVGDVVCCYARCVQKGTTSVSINIEVWVKKVASEPIGQRYKATEALFKYVAVDPE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0036042 - long-chain fatty acyl-CoA binding
GO:0016787 - hydrolase activity
GO:0016790 - thiolester hydrolase activity
GO:0000062 - fatty-acyl-CoA binding
GO:0047617 - acyl-CoA hydrolase activity
biological_process GO:0006637 - acyl-CoA metabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35956N
ECOCYC:
EG11121-MONOMER
ECOLIWIKI:
b1253
INTERPRO:
IPR040170
INTERPRO:
IPR006683
INTERPRO:
IPR029069
INTERPRO:
IPR033120
MODBASE:
P0A8Z0
PANTHER:
PTHR11049
PDB:
2G6S
PFAM:
PF03061
PRIDE:
P0A8Z0
PROSITE:
PS51770
PROTEINMODELPORTAL:
P0A8Z0
REFSEQ:
NP_415769
SMR:
P0A8Z0
SWISSMODEL:
P0A8Z0
UNIPROT:
P0A8Z0


Operon      
Name: yciA         
Operon arrangement:
Transcription unit        Promoter
 


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yciAp8 1312414 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB