RegulonDB RegulonDB 10.7: Gene Form
   

yciC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yciC ompW yciB ArcA NarL CRP FNR FNR RybB ompWp ompWp yciCp yciCp TSS_1685 TSS_1685 yciBp3 yciBp3 yciAp8 yciAp8

Gene      
Name: yciC    Texpresso search in the literature
Synonym(s): ECK1249, EG11123, b1255
Genome position(nucleotides): 1312920 <-- 1313663 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.33
External database links:  
ASAP:
ABE-0004204
ECHOBASE:
EB1113
OU-MICROARRAY:
b1255
PORTECO:
yciC
REGULONDB:
b1255
STRING:
511145.b1255
M3D: yciC
COLOMBOS: yciC
PortEco: b1255


Product      
Name: putative inner membrane protein
Synonym(s): YciC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.419
Isoelectric point: 10.438
Motif(s):
 
Type Positions Sequence
152 -> 172 IIMAILLALAPVMLVQDKMGV
46 -> 46 A
119 -> 119 I
1 -> 244 MSITAQSVYRDTGNFFRNQFMTILLVSLLCAFITVVLGHVFSPSDAQLAQLNDGVPVSGSSGLFDLVQNMSPEQQQILLQASAASTFSGLIGNAILAGGVILIIQLVSAGQRVSALRAIGASAPILPKLFILIFLTTLLVQIGIMLVVVPGIIMAILLALAPVMLVQDKMGVFASMRSSMRLTWANMRLVAPAVLSWLLAKTLLLLFASSFAALTPEIGAVLANTLSNLISAILLIYLFRLYML
20 -> 40 FMTILLVSLLCAFITVVLGHV

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
EG11123-MONOMER
ECOLIWIKI:
b1255
INTERPRO:
IPR009627
PFAM:
PF06790
PRIDE:
P21365
PROTEINMODELPORTAL:
P21365
REFSEQ:
NP_415771
UNIPROT:
P21365


Operon      
Name: yciCB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yciAp8 1312414 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yciBp3 1313055 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1685 1313354 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB