RegulonDB RegulonDB 10.8: Gene Form
   

yciE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ompW yciE yciF RybB yciEp2 yciEp2 yciEp yciEp yciEp7 yciEp7 yciEp6 yciEp6

Gene      
Name: yciE    Texpresso search in the literature
Synonym(s): ECK1251, EG11125, b1257
Genome position(nucleotides): 1314718 <-- 1315224 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.63
External database links:  
ASAP:
ABE-0004212
ECHOBASE:
EB1115
OU-MICROARRAY:
b1257
PortEco:
yciE
STRING:
511145.b1257
COLOMBOS: yciE


Product      
Name: DUF892 domain-containing protein YciE
Synonym(s): YciE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.961
Isoelectric point: 4.673
Motif(s):
 
Type Positions Sequence
5 -> 155 EHYHDWLRDAHAMEKQAESMLESMASRIDNYPELRARIEQHLSETKNQIVQLETILDRNDISRSVIKDSMSKMAALGQSIGGIFPSDEIVKGSISGYVFEQFEIACYTSLLAAAKNAGDTASIPTIEAILNEEKQMADWLIQNIPQTTEKF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11579N
ECOCYC:
EG11125-MONOMER
ECOLIWIKI:
b1257
INTERPRO:
IPR010287
INTERPRO:
IPR009078
INTERPRO:
IPR012347
PFAM:
PF05974
PRIDE:
P21363
REFSEQ:
NP_415773
SMR:
P21363
UNIPROT:
P21363


Operon      
Name: yciGFE         
Operon arrangement:
Transcription unit        Promoter
yciE
yciG
yciGFE


Transcriptional Regulation      
Display Regulation             
Activated by: McbR
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yciEp6 1315238 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yciEp7 1315321 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yciEp2 1315397 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB