RegulonDB RegulonDB 10.8: Gene Form
   

hokD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

relE rem hokD anti-anti-terminator anti-terminator terminator terminator remp2 remp2 remp1 remp1

Gene      
Name: hokD    Texpresso search in the literature
Synonym(s): ECK1556, EG11130, b1562, relF
Genome position(nucleotides): 1645119 <-- 1645274 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.92
External database links:  
ASAP:
ABE-0005219
CGSC:
17953
ECHOBASE:
EB1120
OU-MICROARRAY:
b1562
PortEco:
hokD
STRING:
511145.b1562
COLOMBOS: hokD


Product      
Name: Qin prophage; toxic protein HokD
Synonym(s): HokD, Qin prophage; small toxic polypeptide, RelF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 5.737
Isoelectric point: 6.465
Motif(s):
 
Type Positions Sequence
5 -> 25 KAMLIALIVICLTVIVTALVT
6 -> 47 AMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAY
37 -> 37 G

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0008219 - cell death
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IFC] Inferred by functional complementation
Reference(s): [1] Gerdes K., et al., 1986
[2] Hong SH., et al., 2010
External database links:  
ECOCYC:
EG11130-MONOMER
ECOLIWIKI:
b1562
INTERPRO:
IPR018084
INTERPRO:
IPR000021
PFAM:
PF01848
PRIDE:
P0ACG6
PRINTS:
PR00281
PRODOM:
PD005979
PROSITE:
PS00556
REFSEQ:
NP_416080
UNIPROT:
P0ACG6


Operon      
Name: relBE-hokD         
Operon arrangement:
Transcription unit        Promoter
relBE-hokD
 


Transcriptional Regulation      
Display Regulation             
Repressed by: RelB, RelB-RelE


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter remp1 1644972 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter remp2 1644975 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Gerdes K., Bech FW., Jorgensen ST., Lobner-Olesen A., Rasmussen PB., Atlung T., Boe L., Karlstrom O., Molin S., von Meyenburg K., 1986, Mechanism of postsegregational killing by the hok gene product of the parB system of plasmid R1 and its homology with the relF gene product of the E. coli relB operon., EMBO J 5(8):2023-9

 [2] Hong SH., Wang X., Wood TK., 2010, Controlling biofilm formation, prophage excision and cell death by rewiring global regulator H-NS of Escherichia coli., Microb Biotechnol 3(3):344-56

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB