RegulonDB RegulonDB 10.8: Gene Form
   

relE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydfV relE relB hokD RelB-RelE RelB-RelE RelB RelB-RelE RelB RelB-RelE anti-anti-terminator terminator TSS_1866 TSS_1866 relBp relBp TSS_1865 TSS_1865

Gene      
Name: relE    Texpresso search in the literature
Synonym(s): ECK1557, EG11131, b1563
Genome position(nucleotides): 1645346 <-- 1645633 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.88
External database links:  
ASAP:
ABE-0005221
CGSC:
17956
ECHOBASE:
EB1121
OU-MICROARRAY:
b1563
PortEco:
relE
STRING:
511145.b1563
COLOMBOS: relE


Product      
Name: Qin prophage; mRNA interferase toxin RelE
Synonym(s): Qin prophage, toxin of the RelE-RelB toxin-antitoxin system / cofactor to enhance the repressor activity of RelB, RelE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.225
Isoelectric point: 10.204
Motif(s):
 
Type Positions Sequence
61 -> 61 R
52 -> 52 K
54 -> 54 K
6 -> 83 DFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGKRER
81 -> 81 R

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0043022 - ribosome binding
GO:0003723 - RNA binding
GO:0019843 - rRNA binding
GO:0004521 - endoribonuclease activity
GO:0070181 - small ribosomal subunit rRNA binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0045892 - negative regulation of transcription, DNA-templated
GO:0006402 - mRNA catabolic process
GO:0017148 - negative regulation of translation
GO:0046677 - response to antibiotic
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0034198 - cellular response to amino acid starvation
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
Reference(s): [1] Christensen-Dalsgaard M., et al., 2008
External database links:  
DIP:
DIP-35978N
DISPROT:
DP01881
ECOCYC:
EG11131-MONOMER
ECOLIWIKI:
b1563
INTERPRO:
IPR035093
INTERPRO:
IPR007712
MINT:
MINT-1282331
PDB:
4FXI
PDB:
4V7J
PDB:
2KC8
PDB:
4FXH
PDB:
4FXE
PDB:
2KC9
PDB:
4V7K
PFAM:
PF05016
PRIDE:
P0C077
PRODB:
PRO_000023712
REFSEQ:
NP_416081
SMR:
P0C077
UNIPROT:
P0C077


Operon      
Name: relBE-hokD         
Operon arrangement:
Transcription unit        Promoter
relBE-hokD
 


Transcriptional Regulation      
Display Regulation             
Repressed by: RelB, RelB-RelE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1865 1645901 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1866 1646073 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Christensen-Dalsgaard M., Overgaard M., Winther KS., Gerdes K., 2008, RNA decay by messenger RNA interferases., Methods Enzymol 447:521-35

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB