RegulonDB RegulonDB 10.8: Gene Form
   

nlpC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

btuD ydiV nlpC SdiA IscR nlpCp3 nlpCp3 nlpCp5 nlpCp5 TSS_1999 TSS_1999 TSS_1998 TSS_1998 TSS_1997 TSS_1997 ydiVp ydiVp

Gene      
Name: nlpC    Texpresso search in the literature
Synonym(s): ECK1706, EG11133, b1708
Genome position(nucleotides): 1792267 <-- 1792731 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.68
External database links:  
ASAP:
ABE-0005704
CGSC:
35802
ECHOBASE:
EB1123
OU-MICROARRAY:
b1708
PortEco:
nlpC
STRING:
511145.b1708
COLOMBOS: nlpC


Product      
Name: NlpC/P60 family lipoprotein NlpC
Synonym(s): NlpC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 17.283
Isoelectric point: 9.589
Motif(s):
 
Type Positions Sequence
16 -> 154 CSHHKAPPPNARLSDSITVIAGLNDQLQSWHGTPYRYGGMTRRGVDCSGFVVVTMRDRFDLQLPRETKQQASIGTQIDKDELLPGDLVFFKTGSGQNGLHVGIYDTNNQFIHASTSKGVMRSSLDNVYWQKNFWQARRI
47 -> 153 GTPYRYGGMTRRGVDCSGFVVVTMRDRFDLQLPRETKQQASIGTQIDKDELLPGDLVFFKTGSGQNGLHVGIYDTNNQFIHASTSKGVMRSSLDNVYWQKNFWQARR
1 -> 15 MRFCLILITALLLAG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0008234 - cysteine-type peptidase activity
biological_process GO:0006508 - proteolysis
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Anantharaman V., et al., 2003
[2] Gonnet P., et al., 2004
[3] Ishikawa S., et al., 1998
[4] Juncker AS., et al., 2003
External database links:  
ECOCYC:
EG11133-MONOMER
ECOLIWIKI:
b1708
INTERPRO:
IPR000064
INTERPRO:
IPR038765
PFAM:
PF00877
PRIDE:
P23898
PROSITE:
PS51257
REFSEQ:
NP_416223
SMR:
P23898
UNIPROT:
P23898


Operon      
Name: nlpC         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1997 1792156 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1998 1792191 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1999 1792637 reverse nd [RS-EPT-CBR] [5]
  promoter nlpCp5 1792760 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [5], [6]
  promoter nlpCp3 1792827 reverse Similarity to the consensus
Read more >
[ICWHO] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Anantharaman V., Aravind L., 2003, Evolutionary history, structural features and biochemical diversity of the NlpC/P60 superfamily of enzymes., Genome Biol 4(2):R11

 [2] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [3] Ishikawa S., Hara Y., Ohnishi R., Sekiguchi J., 1998, Regulation of a new cell wall hydrolase gene, cwlF, which affects cell separation in Bacillus subtilis., J Bacteriol 180(9):2549-55

 [4] Juncker AS., Willenbrock H., Von Heijne G., Brunak S., Nielsen H., Krogh A., 2003, Prediction of lipoprotein signal peptides in Gram-negative bacteria., Protein Sci 12(8):1652-62

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB