RegulonDB RegulonDB 10.8: Gene Form
   

ydjA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sppA selD ydjA anti-anti-terminator anti-terminator TSS_2074 TSS_2074 sppAp6 sppAp6 TSS_2073 TSS_2073 ydjAp ydjAp TSS_2072 TSS_2072 selDp2 selDp2 selDp1 selDp1 TSS_2071 TSS_2071

Gene      
Name: ydjA    Texpresso search in the literature
Synonym(s): ECK1763, EG11134, b1765
Genome position(nucleotides): 1848125 <-- 1848676 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.98
External database links:  
ASAP:
ABE-0005875
ECHOBASE:
EB1124
OU-MICROARRAY:
b1765
PortEco:
ydjA
STRING:
511145.b1765
COLOMBOS: ydjA


Product      
Name: putative oxidoreductase YdjA
Synonym(s): YdjA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.059
Isoelectric point: 6.781
Motif(s):
 
Type Positions Sequence
121 -> 126 AAVAQG
131 -> 133 WRS
9 -> 161 NRRSASRLAEPAPTGEQLQNILRAGMRAPDHKSMQPWHFFVIEGEGRERFSAVLEQGAIAAGSDDKAIDKARNAPFRAPLIITVVAKCEENHKVPRWEQEMSAGCAVMAMQMAAVAQGFGGIWRSGALTESPVVREAFGCREQDKIVGFLYLG
10 -> 12 RRS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0010181 - FMN binding
GO:0042803 - protein homodimerization activity
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Choi JW., et al., 2007
External database links:  
DIP:
DIP-31841N
ECOCYC:
EG11134-MONOMER
ECOLIWIKI:
b1765
INTERPRO:
IPR000415
INTERPRO:
IPR026021
INTERPRO:
IPR029479
MINT:
MINT-1239401
MODBASE:
P0ACY1
PDB:
3BM1
PDB:
3BM2
PFAM:
PF00881
PRIDE:
P0ACY1
REFSEQ:
NP_416279
SMR:
P0ACY1
UNIPROT:
P0ACY1


Operon      
Name: ydjA-selD-topB         
Operon arrangement:
Transcription unit        Promoter
selD-topB
selD-topB
ydjA-selD-topB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2071 1847772 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2072 1848030 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2073 1848701 reverse nd [RS-EPT-CBR] [2]
  promoter sppAp6 1848711 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2074 1848792 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Choi JW., Lee J., Kosuke N., Jung CH., Kim JS., 2007, Crystallization and preliminary X-ray diffraction analysis of ydjA, a minimal nitroreductase from Escherichia coli K12., Acta Crystallogr Sect F Struct Biol Cryst Commun 63(Pt 12):1064-6

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB