RegulonDB RegulonDB 10.8: Gene Form
   

pncA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ydjE ansA pncA TSS_2077 TSS_2077 TSS_2076 TSS_2076 TSS_2075 TSS_2075

Gene      
Name: pncA    Texpresso search in the literature
Synonym(s): ECK1766, EG11135, b1768, nam, ydjB
Genome position(nucleotides): 1851887 --> 1852528 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.12
Reference(s): [1] Dickinson ES., et al., 1970
[2] Frothingham R., et al., 1996
[3] Jerlstrom PG., et al., 1989
[4] Suzuki T., et al., 1987
[5] White BJ., et al., 1976
External database links:  
ASAP:
ABE-0005891
ECHOBASE:
EB1125
OU-MICROARRAY:
b1768
PortEco:
pncA
STRING:
511145.b1768
COLOMBOS: pncA


Product      
Name: nicotinamidase
Synonym(s): Nam, PncA, YdjB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 23.362
Isoelectric point: 4.393
Motif(s):
 
Type Positions Sequence
5 -> 207 ALLLVDLQNDFCAGGALAVPEGDSTVDVANRLIDWCQSRGEAVIASQDWHPANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLHQKAIAAVFHKGENPLVDSYSAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVITDGCRGVNIQPQDSAHAFMEMSAAGATLYTLAD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.7 - nicotinamide adenine dinucleotide
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016811 - hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
GO:0008936 - nicotinamidase activity
biological_process GO:0019363 - pyridine nucleotide biosynthetic process
GO:0019365 - pyridine nucleotide salvage
Note(s): Note(s): ...[more].
Reference(s): [2] Frothingham R., et al., 1996
[6] Imsande J. 1961
External database links:  
DIP:
DIP-10520N
ECOCYC:
NICOTINAMID-MONOMER
ECOLIWIKI:
b1768
INTERPRO:
IPR036380
INTERPRO:
IPR000868
MODBASE:
P21369
PFAM:
PF00857
PRIDE:
P21369
PRODB:
PRO_000023560
REFSEQ:
NP_416282
SMR:
P21369
UNIPROT:
P21369


Operon      
Name: ansA-pncA         
Operon arrangement:
Transcription unit        Promoter
ansA-pncA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2075 1851179 forward nd [RS-EPT-CBR] [7]
  promoter TSS_2076 1851322 forward nd [RS-EPT-CBR] [7]
  promoter TSS_2077 1852392 forward nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Dickinson ES., Sundaram TK., 1970, Chromosomal location of a gene defining nicotinamide deamidase in Escherichia coli., J Bacteriol 101(3):1090-1

 [2] Frothingham R., Meeker-O'Connell WA., Talbot EA., George JW., Kreuzer KN., 1996, Identification, cloning, and expression of the Escherichia coli pyrazinamidase and nicotinamidase gene, pncA., Antimicrob Agents Chemother 40(6):1426-31

 [3] Jerlstrom PG., Bezjak DA., Jennings MP., Beacham IR., 1989, Structure and expression in Escherichia coli K-12 of the L-asparaginase I-encoding ansA gene and its flanking regions., Gene 78(1):37-46

 [4] Suzuki T., Itoh A., Ichihara S., Mizushima S., 1987, Characterization of the sppA gene coding for protease IV, a signal peptide peptidase of Escherichia coli., J Bacteriol 169(6):2523-8

 [5] White BJ., Hochhauser SJ., Cintron NM., Weiss B., 1976, Genetic mapping of xthA, the structural gene for exonuclease III in Escherichia coli K-12., J Bacteriol 126(3):1082-8

 [6] Imsande J., 1961, Pathway of diphosphopyridine nucleotide biosynthesis in Escherichia coli., J Biol Chem 236:1494-7

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB