RegulonDB RegulonDB 10.8: Gene Form
   

yebC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yebC ruvC nudB TSS_2213 TSS_2213 TSS_2212 TSS_2212 yebCp yebCp ruvCp ruvCp

Gene      
Name: yebC    Texpresso search in the literature
Synonym(s): ECK1865, EG11137, b1864
Genome position(nucleotides): 1947411 <-- 1948151 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.23
External database links:  
ASAP:
ABE-0006219
ECHOBASE:
EB1127
MIM:
256000
OU-MICROARRAY:
b1864
PortEco:
yebC
STRING:
511145.b1864
COLOMBOS: yebC


Product      
Name: putative transcriptional regulator YebC
Synonym(s): YebC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.423
Isoelectric point: 4.469
Motif(s):
 
Type Positions Sequence
5 -> 235 SKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKGDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDAETAPKLMRLIDMLEDCDDVQEVYHN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0010212 - response to ionizing radiation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-47886N
ECOCYC:
EG11137-MONOMER
ECOLIWIKI:
b1864
INTERPRO:
IPR029072
INTERPRO:
IPR002876
INTERPRO:
IPR017856
INTERPRO:
IPR026564
MINT:
MINT-1241216
MODBASE:
P0A8A0
PANTHER:
PTHR12532
PDB:
1KON
PFAM:
PF01709
PRIDE:
P0A8A0
REFSEQ:
NP_416378
SMR:
P0A8A0
UNIPROT:
P0A8A0


Operon      
Name: nudB-yebC-ruvC         
Operon arrangement:
Transcription unit        Promoter
ruvC
yebC-ruvC
nudB-yebC-ruvC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2212 1948376 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2213 1948462 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB