RegulonDB RegulonDB 10.8: Gene Form
   

nudB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aspS yebC nudB TSS_2218 TSS_2218 TSS_2217 TSS_2217 TSS_2216 (cluster) TSS_2216 (cluster) TSS_2215 TSS_2215 TSS_2214 TSS_2214 nudBp nudBp TSS_2213 TSS_2213 TSS_2212 TSS_2212 yebCp yebCp ruvCp ruvCp

Gene      
Name: nudB    Texpresso search in the literature
Synonym(s): ECK1866, EG11138, b1865, ntpA, yebD
Genome position(nucleotides): 1948180 <-- 1948632 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.54
External database links:  
ASAP:
ABE-0006223
ECHOBASE:
EB1128
OU-MICROARRAY:
b1865
PortEco:
nudB
STRING:
511145.b1865
COLOMBOS: nudB


Product      
Name: dihydroneopterin triphosphate diphosphatase
Synonym(s): NtpA, NudB, Orf17, YebD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.306
Isoelectric point: 6.109
Motif(s):
 
Type Positions Sequence
81 -> 84 FEIF
41 -> 62 GSVEEGETAPQAAMREVKEEVT
5 -> 146 VYKRPVSILVVIYAQDTKRVLMLQRRDDPDFWQSVTGSVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRHRYAPGVTRNTESWFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQFV
8 -> 144 RPVSILVVIYAQDTKRVLMLQRRDDPDFWQSVTGSVEEGETAPQAAMREVKEEVTIDVVAEQLTLIDCQRTVEFEIFSHLRHRYAPGVTRNTESWFCLALPHERQIVFTEHLAYKWLDAPAAAALTKSWSNRQAIEQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.2 - folic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0019177 - dihydroneopterin triphosphate pyrophosphohydrolase activity
GO:0000287 - magnesium ion binding
GO:0008828 - dATP pyrophosphohydrolase activity
biological_process GO:0046656 - folic acid biosynthetic process
GO:0046654 - tetrahydrofolate biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] George KW., et al., 2015
[2] Hori M., et al., 2006
[3] Wang PH., et al., 2018
[4] Zada B., et al., 2018
External database links:  
DIP:
DIP-10372N
ECOCYC:
H2NEOPTERINP3PYROPHOSPHOHYDRO-MONOMER
ECOLIWIKI:
b1865
INTERPRO:
IPR015797
INTERPRO:
IPR020084
INTERPRO:
IPR003564
INTERPRO:
IPR000086
MODBASE:
P0AFC0
PDB:
2O1C
PDB:
2O5W
PFAM:
PF00293
PRIDE:
P0AFC0
PRINTS:
PR01404
PRODB:
PRO_000023420
PROSITE:
PS51462
PROSITE:
PS00893
REFSEQ:
NP_416379
SMR:
P0AFC0
UNIPROT:
P0AFC0


Operon      
Name: nudB-yebC-ruvC         
Operon arrangement:
Transcription unit        Promoter
ruvC
yebC-ruvC
nudB-yebC-ruvC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2212 1948376 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2213 1948462 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2214 1949007 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2215 1949515 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2216 (cluster) 1950222 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_2217 1950276 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2218 1950278 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] George KW., Thompson MG., Kang A., Baidoo E., Wang G., Chan LJ., Adams PD., Petzold CJ., Keasling JD., Lee TS., 2015, Metabolic engineering for the high-yield production of isoprenoid-based C5 alcohols in E. coli., Sci Rep 5:11128

 [2] Hori M., Asanuma T., Inanami O., Kuwabara M., Harashima H., Kamiya H., 2006, Effects of overexpression and antisense RNA expression of Orf17, a MutT-type enzyme., Biol Pharm Bull 29(6):1087-91

 [3] Wang PH., Khusnutdinova AN., Luo F., Xiao J., Nemr K., Flick R., Brown G., Mahadevan R., Edwards EA., Yakunin AF., 2018, Biosynthesis and Activity of Prenylated FMN Cofactors., Cell Chem Biol 25(5):560-570.e6

 [4] Zada B., Wang C., Park JB., Jeong SH., Park JE., Singh HB., Kim SW., 2018, Metabolic engineering of Escherichia coli for production of mixed isoprenoid alcohols and their derivatives., Biotechnol Biofuels 11:210

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB