RegulonDB RegulonDB 10.7: Gene Form
   

yecA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tyrP yecA 3\'ETS<sup><i>leuZ</i></sup> TSS_2245 TSS_2245

Gene      
Name: yecA    Texpresso search in the literature
Synonym(s): ECK1907, EG11139, b1908
Genome position(nucleotides): 1990954 <-- 1991619 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.0
External database links:  
ASAP:
ABE-0006357
ECHOBASE:
EB1129
OU-MICROARRAY:
b1908
PORTECO:
yecA
REGULONDB:
b1908
STRING:
511145.b1908
M3D: yecA
COLOMBOS: yecA
PortEco: b1908


Product      
Name: UPF0149 family protein YecA
Synonym(s): YecA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 25.039
Isoelectric point: 4.24
Motif(s):
 
Type Positions Sequence
203 -> 220 RNDPCPCGSGKKFKQCCL
12 -> 183 EWLDDILTKYNTDHAILDVAELDGLLTAVLSSPQEIEPEQWLVAVWGGADYVPRWASEKEMTRFMNLAFQHMADTAERLNEFPEQFEPLFGLREVDGSELTIVEEWCFGYMRGVALSDWSTLPDSLKPALEAIALHGTEENFERVEKMSPEAFEESVDAIRLAALDLHAYWM
75 -> 76 FM

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48035N
ECOCYC:
EG11139-MONOMER
ECOLIWIKI:
b1908
INTERPRO:
IPR004027
INTERPRO:
IPR011978
INTERPRO:
IPR036255
PFAM:
PF03695
PFAM:
PF02810
PRIDE:
P0AD05
PROTEINMODELPORTAL:
P0AD05
REFSEQ:
NP_416421
UNIPROT:
P0AD05


Operon      
Name: yecA         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2245 1991649 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB