RegulonDB RegulonDB 10.7: Gene Form
   

uvrY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrC uvrY pgsA yecC3\' yecU yecF LexA yecFp yecFp uvrYp2 uvrYp2 TSS_2249 (cluster) TSS_2249 (cluster) uvrCp3 uvrCp3 TSS_2248 TSS_2248 TSS_2247 TSS_2247

Gene      
Name: uvrY    Texpresso search in the literature
Synonym(s): ECK1913, EG11140, b1914, yecB
Genome position(nucleotides): 1994703 <-- 1995359 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.77
External database links:  
ASAP:
ABE-0006373
ECHOBASE:
EB1130
OU-MICROARRAY:
b1914
PORTECO:
uvrY
REGULONDB:
b1914
STRING:
511145.b1914
M3D: uvrY
COLOMBOS: uvrY
PortEco: b1914


Product      
Name: DNA-binding transcriptional activator UvrY
Synonym(s): UvrY, UvrY response regulator, YecB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 23.893
Isoelectric point: 7.044
Motif(s):
 
Type Positions Sequence
149 -> 204 SLSERELQIMLMITKGQKVNEISEQLNLSPKTVNSYRYRMFSKLNIHGDVELTHLA
8 -> 9 DD
3 -> 119 NVLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRTNAVDVVLMDMSMPGIGGLEATRKIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAIRSVY
4 -> 115 VLLVDDHELVRAGIRRILEDIKGIKVVGEASCGEDAVKWCRTNAVDVVLMDMSMPGIGGLEATRKIARSTADVKIIMLTVHTENPLPAKVMQAGAAGYLSKGAAPQEVVSAI
167 -> 186 VNEISEQLNLSPKTVNSYRY

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0000156 - phosphorelay response regulator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[GEA] Gene expression analysis
[IEP] Inferred from expression pattern
[IFC] Inferred by functional complementation
Reference(s): [1] Pernestig AK., et al., 2003
[2] Pernestig AK., et al., 2001
[3] Suzuki K., et al., 2002
External database links:  
DIP:
DIP-35922N
ECOCYC:
EG11140-MONOMER
ECOLIWIKI:
b1914
INTERPRO:
IPR001789
INTERPRO:
IPR016032
INTERPRO:
IPR011006
INTERPRO:
IPR000792
MINT:
MINT-1243107
MODBASE:
P0AED5
PFAM:
PF00196
PFAM:
PF00072
PRIDE:
P0AED5
PRINTS:
PR00038
PRODB:
PRO_000024202
PROSITE:
PS50110
PROSITE:
PS50043
PROSITE:
PS00622
PROTEINMODELPORTAL:
P0AED5
REFSEQ:
NP_416424
SMART:
SM00421
SMART:
SM00448
SMR:
P0AED5
UNIPROT:
P0AED5


Operon      
Name: uvrYC         
Operon arrangement:
Transcription unit        Promoter
uvrC
uvrYC


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2247 1992850 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2248 1994876 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2249 (cluster) 1995403 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Pernestig AK., Georgellis D., Romeo T., Suzuki K., Tomenius H., Normark S., Melefors O., 2003, The Escherichia coli BarA-UvrY two-component system is needed for efficient switching between glycolytic and gluconeogenic carbon sources., J Bacteriol 185(3):843-53

 [2] Pernestig AK., Melefors O., Georgellis D., 2001, Identification of UvrY as the cognate response regulator for the BarA sensor kinase in Escherichia coli., J Biol Chem 276(1):225-31

 [3] Suzuki K., Wang X., Weilbacher T., Pernestig AK., Melefors O., Georgellis D., Babitzke P., Romeo T., 2002, Regulatory circuitry of the CsrA/CsrB and BarA/UvrY systems of Escherichia coli., J Bacteriol 184(18):5130-40

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB