RegulonDB RegulonDB 10.8: Gene Form
   

xapR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xapB xapR lysV Cis-reg xapRp2 xapRp2 xapRp1 xapRp1

Gene      
Name: xapR    Texpresso search in the literature
Synonym(s): ECK2399, EG11146, b2405, pRndR, pndR, yfeB
Genome position(nucleotides): 2521593 <-- 2522477 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.51
External database links:  
ASAP:
ABE-0007922
CGSC:
8
ECHOBASE:
EB1136
ECOO157CYC:
Z3495
OU-MICROARRAY:
b2405
PortEco:
xapR
STRING:
511145.b2405
COLOMBOS: xapR


Shine dalgarno      
Sequence: atttattataTGGAGCacttaatTAT


Product      
Name: DNA-binding transcriptional activator XapR
Synonym(s): PndR, XapR, YfeB
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 33.627
Isoelectric point: 8.975
Motif(s):
 
Type Positions Sequence
93 -> 291 RGEAGRIELGVVGTAMWGRMRPVMRRFLRENPNVDVLFREKMPAMQMALLERRELDAGIWRMATEPPTGFTSLRLHESAFLVAMPEEHHLSSFSTVPLEALRDEYFVTMPPVYTDWDFLQRVCQQVGFSPVVIREVNEPQTVLAMVSMGIGITLIADSYAQMNWPGVIFRPLKQRIPADLYIVYETQQVTPAMVKLLAA
24 -> 43 FGRAAARLNMSQPPLSIHIK
9 -> 68 LKLLRYFLAVAEELHFGRAAARLNMSQPPLSIHIKELENQLGTQLFIRHSRSVVLTHAGK
7 -> 64 TDLKLLRYFLAVAEELHFGRAAARLNMSQPPLSIHIKELENQLGTQLFIRHSRSVVLT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11146-MONOMER
ECOLIWIKI:
b2405
ECOO157CYC:
Z3495-MONOMER
INTERPRO:
IPR036390
INTERPRO:
IPR037409
INTERPRO:
IPR036388
INTERPRO:
IPR005119
INTERPRO:
IPR000847
MODBASE:
P23841
PFAM:
PF03466
PFAM:
PF00126
PRIDE:
P23841
PRINTS:
PR00039
PRODB:
PRO_000024230
PROSITE:
PS50931
REFSEQ:
NP_416900
SMR:
P23841
UNIPROT:
P23841


Operon      
Name: xapR         
Operon arrangement:
Transcription unit        Promoter
xapR
xapR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB