RegulonDB RegulonDB 10.8: Gene Form
   

yffB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dapE yffB ypfM TSS_2765 TSS_2765 TSS_2764 TSS_2764 TSS_2763 TSS_2763 dapEp dapEp TSS_2762 TSS_2762 TSS_2761 TSS_2761 ypfMp2 ypfMp2 TSS_2760 TSS_2760 ypfMp ypfMp TSS_2758 TSS_2758 TSS_2757 (cluster) TSS_2757 (cluster)

Gene      
Name: yffB    Texpresso search in the literature
Synonym(s): ECK2466, EG11147, b2471
Genome position(nucleotides): 2591247 --> 2591603 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.78
External database links:  
ASAP:
ABE-0008140
ECHOBASE:
EB1137
OU-MICROARRAY:
b2471
PortEco:
yffB
STRING:
511145.b2471
COLOMBOS: yffB


Product      
Name: putative reductase YffB
Synonym(s): YffB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.601
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
5 -> 114 YGIKNCDTIKKARRWLEANNIDYRFHDYRVDGLDSELLNDFINELGWEALLNTRGTTWRKLDETTRNKITDAASAAALMTEMPAIIKRPLLCVPGKPMLLGFSDSSYQQF

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12024N
ECOCYC:
EG11147-MONOMER
ECOLIWIKI:
b2471
INTERPRO:
IPR036249
INTERPRO:
IPR006504
INTERPRO:
IPR006660
MINT:
MINT-1255719
MODBASE:
P24178
PANTHER:
PTHR30041:SF7
PFAM:
PF03960
PRIDE:
P24178
PROSITE:
PS51353
REFSEQ:
NP_416966
SMR:
P24178
UNIPROT:
P24178


Operon      
Name: yffB-dapE-ypfN         
Operon arrangement:
Transcription unit        Promoter
dapE-ypfN
yffB-dapE-ypfN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2757 (cluster) 2590885 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2758 2590896 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2760 2591050 reverse nd [RS-EPT-CBR] [1]
  promoter ypfMp2 2591070 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2761 2591293 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2762 2591337 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2763 2592511 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2764 2592549 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2765 2592711 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB