RegulonDB RegulonDB 10.8: Gene Form
   

gcvR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dapA hyfA gcvR bcp FNR FhlA HyfR CRP hyfAp hyfAp bcpp bcpp TSS_2774 TSS_2774 TSS_2773 TSS_2773 gcvRp gcvRp gcvRp2 gcvRp2 dapAp dapAp TSS_2770 TSS_2770 TSS_2769 TSS_2769 bamCp bamCp

Gene      
Name: gcvR    Texpresso search in the literature
Synonym(s): ECK2475, EG11149, b2479, yffD
Genome position(nucleotides): 2599906 --> 2600478 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.09
Reference(s): [1] Ghrist AC., et al., 1998
External database links:  
ASAP:
ABE-0008168
ECHOBASE:
EB1138
OU-MICROARRAY:
b2479
PortEco:
gcvR
STRING:
511145.b2479
COLOMBOS: gcvR


Product      
Name: putative transcriptional regulator GcvR
Synonym(s): GcvR, YffD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.769
Isoelectric point: 5.486
Motif(s):
 
Type Positions Sequence
2 -> 190 TLSSQHYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGEEFTFIMLLSGSWNAITLIESTLPLKGAELDLLIVMKRTTARPRPPMPASVWVQVDVADSPHLIERFTALFDAHHMNIAELVSRTQPAENERAAQLHIQITAHSPASADAANIEQAFKALCTELNAQGSINVVNYSQHDEQDGVK
10 -> 91 VITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGEEFTFIMLLSGSWNAITLIESTLPLKGAELDLLIVMKRTTARPRPP
97 -> 166 WVQVDVADSPHLIERFTALFDAHHMNIAELVSRTQPAENERAAQLHIQITAHSPASADAANIEQAFKALC
7 -> 82 HYLVITALGADRPGIVNTITRHVSSCGCNIEDSRLAMLGEEFTFIMLLSGSWNAITLIESTLPLKGAELDLLIVMK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.3 - amino acids
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.17 - formyl-THF biosynthesis
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
External database links:  
DIP:
DIP-9754N
ECOCYC:
EG11149-MONOMER
ECOLIWIKI:
b2479
INTERPRO:
IPR016867
INTERPRO:
IPR002912
MODBASE:
P0A9I3
PFAM:
PF01842
PRIDE:
P0A9I3
PRODB:
PRO_000022765
PROSITE:
PS51671
REFSEQ:
NP_416974
SMR:
P0A9I3
SWISSMODEL:
P0A9I3
UNIPROT:
P0A9I3


Operon      
Name: gcvR         
Operon arrangement:
Transcription unit        Promoter
gcvR
gcvR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2769 2599483 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2770 2599588 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_2773 2600100 forward nd [RS-EPT-CBR] [2]
  promoter TSS_2774 2600225 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ghrist AC., Stauffer GV., 1998, Promoter characterization and constitutive expression of the Escherichia coli gcvR gene., J Bacteriol 180(7):1803-7

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB