RegulonDB RegulonDB 10.6.3: Gene Form
   

fau gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fau ssrS sibC ibsC SibC sibCp sibCp TSS_3191 (cluster) TSS_3191 (cluster)

Gene      
Name: fau    Texpresso search in the literature
Synonym(s): ECK2907, EG11158, b2912, ygfA
Genome position(nucleotides): 3056241 --> 3056789 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.91
External database links:  
ASAP:
ABE-0009559
ECHOBASE:
EB1147
ECOCYC:
EG11158
ECOLIHUB:
ygfA
OU-MICROARRAY:
b2912
REGULONDB:
b2912
STRING:
511145.b2912
M3D: fau
COLOMBOS: fau
PortEco: b2912


Product      
Name: putative 5-formyltetrahydrofolate cyclo-ligase
Synonym(s): Fau, YgfA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 21.105
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
2 -> 176 IRQRRRALTPEQQQEMGQQAATRMMTYPPVVMAHTVAVFLSFDGELDTQPLIEQLWRAGKRVYLPVLHPFSAGNLLFLNYHPQSELVMNRLKIHEPKLDVRDVLPLSRLDVLITPLVAFDEYGQRLGMGGGFYDRTLQNWQHYKTQPVGYAHDCQLVEKLPVEEWDIPLPAVVTP
128 -> 135 GMGGGFYD

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
GO:0016874 - ligase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0030272 - 5-formyltetrahydrofolate cyclo-ligase activity
biological_process GO:0009396 - folic acid-containing compound biosynthetic process
GO:0022611 - dormancy process
GO:0035999 - tetrahydrofolate interconversion
Note(s): Note(s): ...[more].
Reference(s): [1] Chae H., et al., 2011
[2] Pribat A., et al., 2011
External database links:  
DIP:
DIP-48194N
ECOCYC:
EG11158-MONOMER
ECOLIWIKI:
b2912
INTERPRO:
IPR002698
INTERPRO:
IPR037171
INTERPRO:
IPR024185
MINT:
MINT-1249443
PANTHER:
PTHR23407:SF1
PFAM:
PF01812
PRIDE:
P0AC28
PROTEINMODELPORTAL:
P0AC28
REFSEQ:
NP_417387
SMR:
P0AC28
UNIPROT:
P0AC28


Operon      
Name: ssrS-fau         
Operon arrangement:
Transcription unit        Promoter
ssrS
ssrS-ygfA
ssrS
ssrS-ygfA


Transcriptional Regulation      
Display Regulation             
Activated by: Fis
Repressed by: H-NS, Lrp, StpA, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3191 (cluster) 3055983 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  srna SibC 3056890 3056949 reverse unknow. nd nd


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chae H., Han K., Kim KS., Park H., Lee J., Lee Y., 2011, Rho-dependent termination of ssrS (6S RNA) transcription in Escherichia coli: implication for 3' processing of 6S RNA and expression of downstream ygfA (putative 5-formyl-tetrahydrofolate cyclo-ligase)., J Biol Chem 286(1):114-22

 [2] Pribat A., Blaby IK., Lara-Nunez A., Jeanguenin L., Fouquet R., Frelin O., Gregory JF., Philmus B., Begley TP., de Crecy-Lagard V., Hanson AD., 2011, A 5-formyltetrahydrofolate cycloligase paralog from all domains of life: comparative genomic and experimental evidence for a cryptic role in thiamin metabolism., Funct Integr Genomics 11(3):467-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB