RegulonDB RegulonDB 10.8: Gene Form
   

garK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

garK garR rnpB Fis Fis Fis Fis rnpBp rnpBp

Gene      
Name: garK    Texpresso search in the literature
Synonym(s): ECK3112, EG11175, b3124, yhaD
Genome position(nucleotides): 3270625 <-- 3271770 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.75
External database links:  
ASAP:
ABE-0010271
ECHOBASE:
EB1162
OU-MICROARRAY:
b3124
PortEco:
garK
STRING:
511145.b3124
COLOMBOS: garK


Product      
Name: glycerate 2-kinase 1
Synonym(s): GarK, YhaD, glycerate 2-kinase I
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.104
Isoelectric point: 4.685
Motif(s):
 
Type Positions Sequence
3 -> 373 IVIAPDSYKESLSASEVAQAIEKGFREIFPDAQYVSVPVADGGEGTVEAMIAATQGAERHAWVTGPLGEKVNASWGISGDGKTAFIEMAAASGLELVPAEKRDPLVTTSRGTGELILQALESGATNIIIGIGGSATNDGGAGMVQALGAKLCDANGNEIGFGGGSLNTLNDIDISGLDPRLKDCVIRVACDVTNPLVGDNGASRIFGPQKGASEAMIVELDNNLSHYAEVIKKALHVDVKDVPGAGAAGGMGAALMAFLGAELKSGIEIVTTALNLEEHIHDCTLVITGEGRIDSQSIHGKVPIGVANVAKKYHKPVIGIAGSLTDDVGVVHQHGIDAVFSVLTSIGTLDEAFRGAYDNICRASRNIAATL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008887 - glycerate kinase activity
GO:0043798 - glycerate 2-kinase activity
biological_process GO:0016310 - phosphorylation
GO:0046392 - galactarate catabolic process
GO:0042838 - D-glucarate catabolic process
GO:0031388 - organic acid phosphorylation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-28063N
ECOCYC:
GKI-MONOMER
ECOLIWIKI:
b3124
INTERPRO:
IPR004381
INTERPRO:
IPR018193
INTERPRO:
IPR018197
INTERPRO:
IPR036129
MODBASE:
P23524
PANTHER:
PTHR21599
PFAM:
PF02595
PRIDE:
P23524
PRODB:
PRO_000022751
REFSEQ:
NP_417593
SMR:
P23524
UNIPROT:
P23524


Operon      
Name: garPLRK-rnpB         
Operon arrangement:
Transcription unit        Promoter
rnpB
garR
garPLRK-rnpB


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, CdaR
Repressed by: Fur, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB