RegulonDB RegulonDB 10.8: Gene Form
   

garR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

garK garR garL Fis Fis Fis garRp garRp

Gene      
Name: garR    Texpresso search in the literature
Synonym(s): ECK3113, EG11176, b3125, yhaE
Genome position(nucleotides): 3271867 <-- 3272751 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.99
External database links:  
ASAP:
ABE-0010273
ECHOBASE:
EB1163
OU-MICROARRAY:
b3125
PortEco:
garR
STRING:
511145.b3125
COLOMBOS: garR


Product      
Name: tartronate semialdehyde reductase
Synonym(s): GarR, YhaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.427
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
2 -> 161 KVGFIGLGIMGKPMSKNLLKAGYSLVVADRNPEAIADVIAAGAETASTAKAIAEQCDVIITMLPNSPHVKEVALGENGIIEGAKPGTVLIDMSSIAPLASREISEALKAKGIDMLDAPVSGGEPKAIDGTLSVMVGGDKAIFDKYYDLMKAMAGSVVHTG
4 -> 18 GFIGLGIMGKPMSKN
164 -> 281 GAGNVTKLANQVIVALNIAAMSEALTLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDLANALDTSHGVGAQLPLTAAVMEMMQALRADGLGTADHSALA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0008679 - 2-hydroxy-3-oxopropionate reductase activity
GO:0050661 - NADP binding
GO:0051287 - NAD binding
biological_process GO:0046487 - glyoxylate metabolic process
GO:0046392 - galactarate catabolic process
GO:0042838 - D-glucarate catabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9742N
ECOCYC:
TSA-REDUCT-MONOMER
ECOLIWIKI:
b3125
INTERPRO:
IPR015815
INTERPRO:
IPR036291
INTERPRO:
IPR029154
INTERPRO:
IPR013328
INTERPRO:
IPR008927
INTERPRO:
IPR006398
INTERPRO:
IPR006115
INTERPRO:
IPR002204
MODBASE:
P0ABQ2
PANTHER:
PTHR22981
PFAM:
PF14833
PFAM:
PF03446
PRIDE:
P0ABQ2
PROSITE:
PS00895
REFSEQ:
NP_417594
SMR:
P0ABQ2
SWISSMODEL:
P0ABQ2
UNIPROT:
P0ABQ2


Operon      
Name: garPLRK-rnpB         
Operon arrangement:
Transcription unit        Promoter
rnpB
garR
garPLRK-rnpB


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, CdaR
Repressed by: Fur, H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB