RegulonDB RegulonDB 10.9: Gene Form
   

yiaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

wecH yiaA yiaB TSS_4170 TSS_4170 ysaBp1 ysaBp1

Gene      
Name: yiaA    Texpresso search in the literature
Synonym(s): ECK3551, EG11186, b3562
Genome position(nucleotides): 3726924 <-- 3727361 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
41.1
External database links:  
ASAP:
ABE-0011632
ECHOBASE:
EB1172
ECOLIHUB:
yiaA
OU-MICROARRAY:
b3562
STRING:
511145.b3562
COLOMBOS: yiaA


Product      
Name: PF05360 family inner membrane protein YiaA
Synonym(s): YiaA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 16.123
Isoelectric point: 4.724
Motif(s):
 
Type Positions Sequence
72 -> 94 TSIYYMTCLTVFIISVALLMVGL
12 -> 64 FSIVSWIALVGGIVTYLLGLWNAEMQLNEKGYYFAVLVLGLFSAASYQKTVRD
13 -> 32 SIVSWIALVGGIVTYLLGLW
99 -> 121 LLLSEKGFYGLAFFLSLFGAVAV
75 -> 127 YYMTCLTVFIISVALLMVGLWNATLLLSEKGFYGLAFFLSLFGAVAVQKNIRD

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006974 - cellular response to DNA damage stimulus
Note(s): Note(s): ...[more].
Reference(s): [1] Savage DF., et al., 2007
External database links:  
ECOCYC:
EG11186-MONOMER
ECOLIWIKI:
b3562
INTERPRO:
IPR008024
INTERPRO:
IPR038972
PANTHER:
PTHR37290
PFAM:
PF05360
PRIDE:
P0ADJ8
REFSEQ:
NP_418019
UNIPROT:
P0ADJ8


Operon      
Name: yiaA         
Operon arrangement:
Transcription unit        Promoter
yiaA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ysaBp1 3725902 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4170 3727282 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Savage DF., Anderson CL., Robles-Colmenares Y., Newby ZE., Stroud RM., 2007, Cell-free complements in vivo expression of the E. coli membrane proteome., Protein Sci 16(5):966-76

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB