RegulonDB RegulonDB 10.8: Gene Form
   

mioC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mnmG asnC mioC MraZ MraZ MraZ ppGpp ppGpp anti-anti-terminator anti-terminator terminator mioCp mioCp TSS_4348 TSS_4348 TSS_4347 TSS_4347 mnmGp mnmGp TSS_4346 TSS_4346 TSS_4345 TSS_4345 rsmGp rsmGp

Gene      
Name: mioC    Texpresso search in the literature
Synonym(s): ECK3736, EG11199, b3742, yieB
Genome position(nucleotides): 3926012 <-- 3926455 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0012235
CGSC:
18154
ECHOBASE:
EB1185
OU-MICROARRAY:
b3742
PortEco:
mioC
STRING:
511145.b3742
COLOMBOS: mioC


Product      
Name: flavoprotein MioC
Synonym(s): MioC, YieB, flavoprotein involved in biotin synthesis
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.808
Isoelectric point: 4.037
Motif(s):
 
Type Positions Sequence
56 -> 99 THGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFC
2 -> 147 ADITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWVNLLK
7 -> 138 ISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEW
4 -> 143 ITLISGSTLGGAEYVAEHLAEKLEEAGFTTETLHGPLLEDLPASGIWLVISSTHGAGDIPDNLSPFYEALQEQKPDLSAVRFGAIGIGSREYDTFCGAIDKLEAELKNSGAKQTGETLKINILDHDIPEDPAEEWLGSWV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.1 - biotin
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0010181 - FMN binding
biological_process GO:0051302 - regulation of cell division
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Reference(s): [1] Hansen FG., et al., 2007
[2] Hansen FG., et al., 2006
[3] Wei Y., et al., 2001
External database links:  
ECOCYC:
EG11199-MONOMER
ECOLIWIKI:
b3742
INTERPRO:
IPR008254
INTERPRO:
IPR029039
MODBASE:
P03817
PDB:
2HNA
PDB:
2HNB
PFAM:
PF00258
PRIDE:
P03817
PRODB:
PRO_000023240
PROSITE:
PS50902
REFSEQ:
NP_418198
SMR:
P03817
UNIPROT:
P03817


Operon      
Name: asnC-mioC-mnmG-rsmG         
Operon arrangement:
Transcription unit        Promoter
mnmG-rsmG
mioC
asnC
asnC-mioC
asnC-mioC-mnmG
rsmG


Transcriptional Regulation      
Display Regulation             
Repressed by: Nac, MraZ, AsnC


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rsmGp 3923756 reverse nd [AIPP] [4]
  promoter TSS_4345 3924313 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4346 3924964 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4347 3925679 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4348 3926009 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [AIPP] Automated inference of promoter position

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hansen FG., Christensen BB., Atlung T., 2007, Sequence characteristics required for cooperative binding and efficient in vivo titration of the replication initiator protein DnaA in E. coli., J Mol Biol 367(4):942-52

 [2] Hansen FG., Christensen BB., Nielsen CB., Atlung T., 2006, Insights into the quality of DnaA boxes and their cooperativity., J Mol Biol 355(1):85-95

 [3] Wei Y., Lee JM., Smulski DR., LaRossa RA., 2001, Global impact of sdiA amplification revealed by comprehensive gene expression profiling of Escherichia coli., J Bacteriol 183(7):2265-72

 [4] Benitez-Paez A., Villarroya M., Armengod ME., 2012, Regulation of expression and catalytic activity of Escherichia coli RsmG methyltransferase., RNA 18(4):795-806

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB