RegulonDB RegulonDB 10.9: Gene Form
   

psiE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

xylE psiE yjbT CRP PhoB PhoB psiEp psiEp

Gene      
Name: psiE    Texpresso search in the literature
Synonym(s): ECK4022, EG11209, b4030, yjbA
Genome position(nucleotides): 4240325 --> 4240735 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.15
External database links:  
ASAP:
ABE-0013187
ECHOBASE:
EB1194
ECOLIHUB:
psiE
OU-MICROARRAY:
b4030
STRING:
511145.b4030
COLOMBOS: psiE


Product      
Name: putative phosphate starvation-inducible protein PsiE
Synonym(s): PsiE, YjbA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 15.597
Isoelectric point: 8.668
Motif(s):
 
Type Positions Sequence
108 -> 128 PLDVLIYSAAILLLVITLWLC
15 -> 35 ILQTVLNLGLLCLGLILVVFL
82 -> 102 FHFPLRYFVYIGITAIVRLII
61 -> 123 LVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVDHKSPLDVLIYSAAILLLVI
55 -> 75 YELVEGLVVYFLYFEFIALIV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0016036 - cellular response to phosphate starvation
Note(s): Note(s): ...[more].
Reference(s): [1] Metcalf WW., et al., 1990
[2] Savage DF., et al., 2007
[3] Serres MH., et al., 2001
External database links:  
ECOCYC:
EG11209-MONOMER
ECOLIWIKI:
b4030
INTERPRO:
IPR020948
INTERPRO:
IPR009315
PANTHER:
PTHR37819
PFAM:
PF06146
PRIDE:
P0A7C8
PRODB:
PRO_000023612
REFSEQ:
NP_418454
UNIPROT:
P0A7C8


Operon      
Name: psiE         
Operon arrangement:
Transcription unit        Promoter
psiE


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB
Repressed by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Metcalf WW., Steed PM., Wanner BL., 1990, Identification of phosphate starvation-inducible genes in Escherichia coli K-12 by DNA sequence analysis of psi::lacZ(Mu d1) transcriptional fusions., J Bacteriol 172(6):3191-200

 [2] Savage DF., Anderson CL., Robles-Colmenares Y., Newby ZE., Stroud RM., 2007, Cell-free complements in vivo expression of the E. coli membrane proteome., Protein Sci 16(5):966-76

 [3] Serres MH., Gopal S., Nahum LA., Liang P., Gaasterland T., Riley M., 2001, A functional update of the Escherichia coli K-12 genome., Genome Biol 2(9):RESEARCH0035


RegulonDB