RegulonDB RegulonDB 10.7: Gene Form
   

creA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rob creB creA ytjC NagC SoxS Rob MarA creAp creAp robp robp creAp2 creAp2 TSS_5185 TSS_5185 TSS_5184 TSS_5184 TSS_5183 TSS_5183

Gene      
Name: creA    Texpresso search in the literature
Synonym(s): ECK4389, EG11217, b4397, yjjD
Genome position(nucleotides): 4635521 --> 4635994 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.95
External database links:  
ASAP:
ABE-0014426
CGSC:
34809
ECHOBASE:
EB1200
OU-MICROARRAY:
b4397
PORTECO:
creA
REGULONDB:
b4397
STRING:
511145.b4397
M3D: creA
COLOMBOS: creA
PortEco: b4397


Shine dalgarno      
Sequence: tagataaaaaTGGTAAcaatATG


Product      
Name: PF05981 family protein CreA
Synonym(s): CreA, YjjD, conserved protein CreA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.108
Isoelectric point: 9.385
Motif(s):
 
Type Positions Sequence
1 -> 21 MKYKHLILSLSLIMLGPLAHA
22 -> 157 EEIGSVDTVFKMIGPDHKIVVEAFDDPDVKNVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIELSDRIKNGKAQGEVVFKKRTSLVFKSLQVVRFYDAKRNALAYLAYSDKVVEGSPKNAISAVPVMPWRQ
24 -> 155 IGSVDTVFKMIGPDHKIVVEAFDDPDVKNVTCYVSRAKTGGIKGGLGLAEDTSDAAISCQQVGPIELSDRIKNGKAQGEVVFKKRTSLVFKSLQVVRFYDAKRNALAYLAYSDKVVEGSPKNAISAVPVMPW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Reference(s): [1] Cariss SJ., et al., 2008
External database links:  
ECOCYC:
EG11217-MONOMER
ECOLIWIKI:
b4397
INTERPRO:
IPR010292
PANTHER:
PTHR37952
PFAM:
PF05981
PRIDE:
P0AE91
PROTEINMODELPORTAL:
P0AE91
REFSEQ:
NP_418814
UNIPROT:
P0AE91


Operon      
Name: creABCD         
Operon arrangement:
Transcription unit        Promoter
creABC
creABCD
creD


Transcriptional Regulation      
Display Regulation             
Repressed by: NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5183 4634537 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5184 4634582 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_5185 4635151 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Cariss SJ., Tayler AE., Avison MB., 2008, Defining the growth conditions and promoter-proximal DNA sequences required for activation of gene expression by CreBC in Escherichia coli., J Bacteriol 190(11):3930-9

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB