RegulonDB RegulonDB 10.8: Gene Form
   

creB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

creC creD creB creA CreB terminator creDp creDp

Gene      
Name: creB    Texpresso search in the literature
Synonym(s): ECK4390, EG11218, ORF2, b4398, yjjE
Genome position(nucleotides): 4636007 --> 4636696 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.22
External database links:  
ASAP:
ABE-0014428
CGSC:
34803
ECHOBASE:
EB1201
OU-MICROARRAY:
b4398
PortEco:
creB
STRING:
511145.b4398
COLOMBOS: creB


Shine dalgarno      
Sequence: ggcaataacaGAGGCGatttATG


Product      
Name: DNA-binding transcriptional regulator CreB
Synonym(s): CreB, CreB response regulator, YjjE
Sequence: Get amino acid sequence Fasta Format
Regulator Family: OmpR
Cellular location: cytosol
Molecular weight: 26.125
Isoelectric point: 6.532
Motif(s):
 
Type Positions Sequence
5 -> 119 TVWLVEDEQGIADTLVYMLQQEGFAVEVFERGLPVLDKARKQVPDVMILDVGLPDISGFELCRQLLALHPALPVLFLTARSEEVDRLLGLEIGADDYVAKPFSPREVCARVRTLL
129 -> 228 SPVIRIGHFELNEPAAQISWFDTPLALTRYEFLLLKTLLKSPGRVWSRQQLMDSVWEDAQDTYDRTVDTHIKTLRAKLRAINPDLSPINTHRGMGYSLRG
151 -> 226 TPLALTRYEFLLLKTLLKSPGRVWSRQQLMDSVWEDAQDTYDRTVDTHIKTLRAKLRAINPDLSPINTHRGMGYSL
6 -> 115 VWLVEDEQGIADTLVYMLQQEGFAVEVFERGLPVLDKARKQVPDVMILDVGLPDISGFELCRQLLALHPALPVLFLTARSEEVDRLLGLEIGADDYVAKPFSPREVCARV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0042802 - identical protein binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0000986 - bacterial-type cis-regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
Reference(s): [1] Pao GM., et al., 1995
[2] Parkinson JS. 1993
[3] Parkinson JS., et al., 1992
[4] Saier MH. 1994
[5] Stock JB., et al., 1990
External database links:  
DIP:
DIP-9318N
ECOCYC:
CREB-MONOMER
ECOLIWIKI:
b4398
INTERPRO:
IPR036388
INTERPRO:
IPR039420
INTERPRO:
IPR016032
INTERPRO:
IPR011006
INTERPRO:
IPR001867
INTERPRO:
IPR001789
MODBASE:
P08368
PANTHER:
PTHR26402
PFAM:
PF00486
PFAM:
PF00072
PRIDE:
P08368
PRODB:
PRO_000022329
PROSITE:
PS51755
PROSITE:
PS50110
REFSEQ:
NP_418815
SMART:
SM00862
SMART:
SM00448
SMR:
P08368
SWISSMODEL:
P08368
UNIPROT:
P08368


Operon      
Name: creABCD         
Operon arrangement:
Transcription unit        Promoter
creABC
creABCD
creD


Transcriptional Regulation      
Display Regulation             
Repressed by: NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [2] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [3] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [4] Saier MH., 1994, Bacterial sensor kinase/response regulator systems: an introduction., Res Microbiol 145(5-6):349-55

 [5] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400


RegulonDB