RegulonDB RegulonDB 10.8: Gene Form
   

argH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

argH argB oxyS oxySp oxySp TSS_4687 (cluster) TSS_4687 (cluster)

Gene      
Name: argH    Texpresso search in the literature
Synonym(s): ECK3951, EG11223, b3960
Genome position(nucleotides): 4156850 --> 4158223 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.48
External database links:  
ASAP:
ABE-0012969
CGSC:
1014
ECHOBASE:
EB1205
MIM:
207900
NCBI-GENE:
948463
OU-MICROARRAY:
b3960
PortEco:
argH
STRING:
511145.b3960
COLOMBOS: argH


Product      
Name: argininosuccinate lyase
Synonym(s): ArgH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 50.318
Isoelectric point: 4.902
Motif(s):
 
Type Positions Sequence
40 -> 40 W
6 -> 301 GRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSVAWSKALVTVGVLTAEEQAQLEEALNVLLEDVRARPQQILESDAEDIHSWVEGKLIDKVGQLGKKLHTGRSRNDQVATDLKLWCKDTVSELLTANRQLQSALVETAQNNQDAVMPGYTHLQRAQPVTFAHWCLAYVEMLARDESRLQDALKRLDVSPLGCGALAGTAYEIDREQLAGWLGFASATRNSLDSVSDRDHVLELLSAAAIGMVHLSRFAEDLIFFNTGEAGFVELSDRVTSGSSLMPQKKNPDALELIRGKCGRVQG
28 -> 28 R
364 -> 431 YANATELADYLVAKGVPFREAHHIVGEAVVEAIRQGKPLEDLPLSELQKFSQVIDEDVYPILSLQSCL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.3 - arginine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0004056 - argininosuccinate lyase activity
biological_process GO:0006526 - arginine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0042450 - arginine biosynthetic process via ornithine
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9142N
ECOCYC:
ARGSUCCINLYA-MONOMER
ECOLIWIKI:
b3960
INTERPRO:
IPR020557
INTERPRO:
IPR029419
INTERPRO:
IPR024083
INTERPRO:
IPR022761
INTERPRO:
IPR009049
INTERPRO:
IPR008948
INTERPRO:
IPR000362
MODBASE:
P11447
PANTHER:
PTHR43814
PDB:
1TJ7
PFAM:
PF00206
PFAM:
PF14698
PRIDE:
P11447
PRINTS:
PR00149
PROSITE:
PS00163
REFSEQ:
NP_418395
SMR:
P11447
UNIPROT:
P11447


Operon      
Name: argCBH         
Operon arrangement:
Transcription unit        Promoter
argCBH
argH


Transcriptional Regulation      
Display Regulation             
Repressed by: ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4687 (cluster) 4157619 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB