RegulonDB RegulonDB 10.7: Gene Form
   

fdnG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fdnG fdnH yddG fdnI FNR NarL FNR NarP NarL NarP NarL NarL Cis-reg terminator anti-terminator anti-anti-terminator terminator fdnGp fdnGp yddGp yddGp TSS_1829 TSS_1829

Gene      
Name: fdnG    Texpresso search in the literature
Synonym(s): ECK1468, EG11227, b1474
Genome position(nucleotides): 1547401 --> 1550448 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.17
External database links:  
ASAP:
ABE-0004917
CGSC:
32160
ECHOBASE:
EB1209
OU-MICROARRAY:
b1474
PORTECO:
fdnG
REGULONDB:
b1474
STRING:
511145.b1474
M3D: fdnG
COLOMBOS: fdnG
PortEco: b1474


Product      
Name: formate dehydrogenase N subunit α
Synonym(s): FdnG
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,membrane
Molecular weight: 112.963
Isoelectric point: 7.0
Motif(s):
 
Type Positions Sequence
893 -> 1008 TTYRLTEHFHTWTKHALLNAIAQPEQFVEISETLAAAKGINNGDRVTVSSKRGFIRAVAVVTRRLKPLNVNGQQVETVGIPIHWGFEGVARKGYIANTLTPNVGDANSQTPEYKAF
96 -> 96 A
941 -> 941 S
484 -> 491 ANTPKATL
44 -> 104 KEIRNTCTYCSVGCGLLMYSLGDGAKNAREAIYHIEGDPDHPVSRGALCPKGAGLLDYVNS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0009326 - formate dehydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008863 - formate dehydrogenase (NAD+) activity
GO:0008430 - selenium binding
GO:0030151 - molybdenum ion binding
GO:0043546 - molybdopterin cofactor binding
GO:0036397 - formate dehydrogenase (quinone) activity
GO:0047111 - formate dehydrogenase (cytochrome-c-553) activity
biological_process GO:0045333 - cellular respiration
GO:0009061 - anaerobic respiration
GO:0022900 - electron transport chain
GO:0055114 - oxidation-reduction process
GO:0015944 - formate oxidation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-9573N
ECOCYC:
FDNG-MONOMER
ECOLIWIKI:
b1474
INTERPRO:
IPR027467
INTERPRO:
IPR006311
INTERPRO:
IPR006963
INTERPRO:
IPR009010
INTERPRO:
IPR006443
INTERPRO:
IPR006655
INTERPRO:
IPR006656
INTERPRO:
IPR006657
MINT:
MINT-1236143
MODBASE:
P24183
PDB:
1KQG
PDB:
1KQF
PFAM:
PF01568
PFAM:
PF00384
PFAM:
PF04879
PRIDE:
P24183
PRODB:
PRO_000022581
PROSITE:
PS51669
PROSITE:
PS51318
PROSITE:
PS00932
PROSITE:
PS00551
PROTEINMODELPORTAL:
P24183
REFSEQ:
NP_415991
SMART:
SM00926
SMR:
P24183
UNIPROT:
P24183


Operon      
Name: fdnGHI         
Operon arrangement:
Transcription unit        Promoter
fdnGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, NarL
Repressed by: FNR, NarP


RNA cis-regulatory element    
Attenuation: Transcriptional
   
Cis-reg Selenocysteine insertion sequence 3
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1829 1547203 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB