RegulonDB RegulonDB 10.7: Gene Form
   

fdnI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fdnG fdnH fdnI C0362 yddM Cis-reg

Gene      
Name: fdnI    Texpresso search in the literature
Synonym(s): ECK1470, EG11229, b1476
Genome position(nucleotides): 1551338 --> 1551991 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.69
External database links:  
ASAP:
ABE-0004921
CGSC:
32168
ECHOBASE:
EB1211
OU-MICROARRAY:
b1476
PORTECO:
fdnI
REGULONDB:
b1476
STRING:
511145.b1476
M3D: fdnI
COLOMBOS: fdnI
PortEco: b1476


Product      
Name: formate dehydrogenase N subunit γ
Synonym(s): FdnI, formate dehydrogenase N cytochrome b subunit
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 25.368
Isoelectric point: 10.584
Motif(s):
 
Type Positions Sequence
111 -> 134 AGQKMMFWSIMSMIFVLLVTGVII
160 -> 217 IILIHAILIHMYMAFWVKGSIKGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
13 -> 186 IDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFFGIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSIMSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSIKGMIEG
12 -> 36 FIDRACHWTVVICFFLVALSGISFF
53 -> 74 GRILHPFFGIAIFVALMFMFVR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.1 - electron donors
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.15 - large molecule carriers --> 1.6.15.1 - cytochromes
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009326 - formate dehydrogenase complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0008863 - formate dehydrogenase (NAD+) activity
GO:0020037 - heme binding
GO:0036397 - formate dehydrogenase (quinone) activity
biological_process GO:0045333 - cellular respiration
GO:0009061 - anaerobic respiration
GO:0022904 - respiratory electron transport chain
GO:0055114 - oxidation-reduction process
GO:0015944 - formate oxidation
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
FDNI-MONOMER
ECOLIWIKI:
b1476
INTERPRO:
IPR006471
INTERPRO:
IPR016174
INTERPRO:
IPR011577
MODBASE:
P0AEK7
PANTHER:
PTHR30074:SF2
PDB:
1KQG
PDB:
1KQF
PFAM:
PF01292
PRIDE:
P0AEK7
PRODB:
PRO_000022583
PROTEINMODELPORTAL:
P0AEK7
REFSEQ:
NP_415993
SMR:
P0AEK7
SWISSMODEL:
P0AEK7
UNIPROT:
P0AEK7


Operon      
Name: fdnGHI         
Operon arrangement:
Transcription unit        Promoter
fdnGHI


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, NarL
Repressed by: FNR, NarP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB