RegulonDB RegulonDB 10.8: Gene Form
   

rstB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rstB tus rstA fumC tusp2 tusp2

Gene      
Name: rstB    Texpresso search in the literature
Synonym(s): ECK1604, EG11233, b1609, uspT
Genome position(nucleotides): 1682882 --> 1684183 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.69
External database links:  
ASAP:
ABE-0005372
ECHOBASE:
EB1215
OU-MICROARRAY:
b1609
PortEco:
rstB
STRING:
511145.b1609
COLOMBOS: rstB


Product      
Name: sensory histidine kinase RstB
Synonym(s): RstB, UspT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 49.283
Isoelectric point: 6.198
Motif(s):
 
Type Positions Sequence
166 -> 206 KLEAAAQRFGDGHLNERIHFDEGSSFERLGVAFNQMADNIN
320 -> 423 MERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPGIAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSELGGARFSFSWPL
218 -> 425 GIAHELRTPLVRLRYRLEMSDNLSAAESQALNRDISQLEALIEELLTYARLDRPQNELHLSEPDLPLWLSTHLADIQAVTPDKTVRIKTLVQGHYAALDMRLMERVLDNLLNNALRYCHSTVETSLLLSGNRATLIVEDDGPGIAPENREHIFEPFVRLDPSRDRSTGGCGLGLAIVHSIALAMGGTVNCDTSELGGARFSFSWPLWH
211 -> 269 SKKQLIDGIAHELRTPLVRLRYRLEMSDNLSAAESQALNRDISQLEALIEELLTYARLD
4 -> 24 LFIQFYLLLFVCFLVMSLLVG

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0016310 - phosphorylation
GO:0047484 - regulation of response to osmotic stress
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0023014 - signal transduction by protein phosphorylation
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Yamamoto K., et al., 2005
External database links:  
DIP:
DIP-10808N
ECOCYC:
RSTB-MONOMER
ECOLIWIKI:
b1609
INTERPRO:
IPR003594
INTERPRO:
IPR036097
INTERPRO:
IPR005467
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR036890
INTERPRO:
IPR003660
MODBASE:
P18392
PFAM:
PF00512
PFAM:
PF00672
PFAM:
PF02518
PRIDE:
P18392
PRINTS:
PR00344
PRODB:
PRO_000023890
PROSITE:
PS50109
PROSITE:
PS50885
REFSEQ:
NP_416126
SMART:
SM00304
SMART:
SM00387
SMART:
SM00388
SMR:
P18392
SWISSMODEL:
P18392
UNIPROT:
P18392


Operon      
Name: rstAB         
Operon arrangement:
Transcription unit        Promoter
rstAB


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tusp2 1684173 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Yamamoto K., Hirao K., Oshima T., Aiba H., Utsumi R., Ishihama A., 2005, Functional characterization in vitro of all two-component signal transduction systems from Escherichia coli., J Biol Chem 280(2):1448-56

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB