RegulonDB RegulonDB 10.8: Gene Form
   

chiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

chiA tufA bfd anti-anti-terminator anti-terminator terminator TSS_3856 TSS_3856 TSS_3855 (cluster) TSS_3855 (cluster) TSS_3854 (cluster) TSS_3854 (cluster) TSS_3853 TSS_3853 TSS_3852 TSS_3852 TSS_3851 (cluster) TSS_3851 (cluster) TSS_3850 TSS_3850 TSS_3849 TSS_3849 TSS_3848 TSS_3848 TSS_3847 TSS_3847 TSS_3846 TSS_3846 TSS_3845 TSS_3845 TSS_3844 (cluster) TSS_3844 (cluster) TSS_3843 TSS_3843 TSS_3842 (cluster) TSS_3842 (cluster) TSS_3841 TSS_3841 TSS_3840 TSS_3840 TSS_3839 TSS_3839 TSS_3838 TSS_3838 TSS_3837 TSS_3837 chiAp chiAp TSS_3836 TSS_3836

Gene      
Name: chiA    Texpresso search in the literature
Synonym(s): ECK3325, EG11237, b3338, yheB
Genome position(nucleotides): 3467160 <-- 3469853 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.37
Reference(s): [1] Francetic O., et al., 2000
External database links:  
ASAP:
ABE-0010909
ECHOBASE:
EB1219
OU-MICROARRAY:
b3338
PortEco:
chiA
STRING:
511145.b3338
COLOMBOS: chiA


Shine dalgarno      
Sequence: tttacgtcacAAGGGAttatAAT


Product      
Name: endochitinase
Synonym(s): ChiA, YheB
Sequence: Get amino acid sequence Fasta Format
Cellular location: extracellular space,periplasmic space
Molecular weight: 97.057
Isoelectric point: 5.347
Motif(s):
 
Type Positions Sequence
128 -> 194 VVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKSNDASNPWRYVRAATATEISETSNPQSCT
459 -> 529 AKAWSASTVYVKGDRVVVDGQAYEALFWTQSDNPALVANQNATGSNSRPWKPLGKAQSYSNEELNNAPQFN
647 -> 897 IKALREAGGDVMLSIGGANNAPLAASCKNVDDLMQHYYDIVDNLNLKVLDFDIEGTWVADQASIERRNLAVKKVQDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAICQSANTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYLSDARLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
25 -> 897 MEAWNNQQGGNKYQVIFDGKIYENAWWVSSTNCPGKAKANDATNPWRLKRTATAAEISQFGNTLSCEKSGSSSSSNSNTPASNTPANGGSATPAQGTVPSNSSVVAWNKQQGGQTWYVVFNGAVYKNAWWVASSNCPGDAKSNDASNPWRYVRAATATEISETSNPQSCTSAPQPSPDVKPAPDVKPAPDVQPAPADKSNDNYAVVAWKGQEGSSTWYVIYNGGIYKNAWWVGAANCPGDAKENDASNPWRYVRAATATEISQYGNPGSCSVKPDNNGGAVTPVDPTPETPVTPTPDNSEPSTPADSVNDYSLQAWSGQEGSEIYHVIFNGNVYKNAWWVGSKDCPRGTSAENSNNPWRLERTATAAELSQYGNPTTCEIDNGGVIVADGFQASKAYSADSIVDYNDAHYKTSVDQDAWGFVPGGDNPWKKYEPAKAWSASTVYVKGDRVVVDGQAYEALFWTQSDNPALVANQNATGSNSRPWKPLGKAQSYSNEELNNAPQFNPETLYASDTLIRFNGVNYISQSKVQKVSPSDSNPWRVFVDWTGTKERVGTPKKAWPKHVYAPYVDFTLNTIPDLAALAKNHNVNHFTLAFVVSKDANTCLPTWGTAYGMQNYAQYSKIKALREAGGDVMLSIGGANNAPLAASCKNVDDLMQHYYDIVDNLNLKVLDFDIEGTWVADQASIERRNLAVKKVQDKWKSEGKDIAIWYTLPILPTGLTPEGMNVLSDAKAKGVELAGVNVMTMDYGNAICQSANTEGQNIHGKCATSAIANLHSQLKGLHPNKSDAEIDAMMGTTPMVGVNDVQGEVFYLSDARLVMQDAQKRNLGMVGIWSIARDLPGGTNLSPEFHGLTKEQAPKYAFSEIFAPFTKQ
93 -> 101 SGSSSSSNS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0005576 - extracellular region
molecular_function GO:0003824 - catalytic activity
GO:0016787 - hydrolase activity
GO:0004553 - hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004568 - chitinase activity
GO:0008843 - endochitinase activity
GO:0003796 - lysozyme activity
GO:0030246 - carbohydrate binding
GO:0008061 - chitin binding
biological_process GO:0008152 - metabolic process
GO:0000272 - polysaccharide catabolic process
GO:0005975 - carbohydrate metabolic process
GO:0006032 - chitin catabolic process
Note(s): Note(s): ...[more].
Evidence: [IE] Inferred from experiment
External database links:  
CAZY:
CBM5
CAZY:
GH18
DIP:
DIP-9276N
ECOCYC:
EG11237-MONOMER
ECOLIWIKI:
b3338
INTERPRO:
IPR003610
INTERPRO:
IPR036573
INTERPRO:
IPR017853
MODBASE:
P13656
PFAM:
PF02839
PRIDE:
P13656
PROSITE:
PS01095
REFSEQ:
NP_417797
SMART:
SM00495
SMR:
P13656
UNIPROT:
P13656


Operon      
Name: chiA         
Operon arrangement:
Transcription unit        Promoter
chiA


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3836 3467147 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3837 3470298 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3838 3470546 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3839 3470604 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3840 3470613 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3841 3470676 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3842 (cluster) 3470680 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3843 3470682 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3844 (cluster) 3470687 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3845 3470828 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3846 3470844 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3847 3471157 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3848 3471182 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3849 3471250 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3850 3471278 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3851 (cluster) 3471295 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3852 3471297 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3853 3471305 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3854 (cluster) 3471309 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3855 (cluster) 3471319 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3856 3471327 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Francetic O., Badaut C., Rimsky S., Pugsley AP., 2000, The ChiA (YheB) protein of Escherichia coli K-12 is an endochitinase whose gene is negatively controlled by the nucleoid-structuring protein H-NS., Mol Microbiol 35(6):1506-17

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB