RegulonDB RegulonDB 10.8: Gene Form
   

ybhB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bioA ybhC ybhB ybhBp2 ybhBp2 ybhBp4 ybhBp4 TSS_940 (cluster) TSS_940 (cluster) ybhCp ybhCp TSS_939 TSS_939

Gene      
Name: ybhB    Texpresso search in the literature
Synonym(s): ECK0762, EG11238, b0773
Genome position(nucleotides): 807433 <-- 807909 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.41
External database links:  
ASAP:
ABE-0002632
ECHOBASE:
EB1220
OU-MICROARRAY:
b0773
PortEco:
ybhB
STRING:
511145.b0773
COLOMBOS: ybhB


Product      
Name: putative kinase inhibitor
Synonym(s): YbhB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.085
Isoelectric point: 5.423
Motif(s):
 
Type Positions Sequence
136 -> 136 G
15 -> 157 PHRHVFNGMGYDGDNISPHLAWDDVPAGTKSFVVTCYDPDAPTGSGWWHWVVVNLPADTRVLPQGFGSGLVAMPDGVLQTRTDFGKTGYDGAAPPKGETHRYIFTVHALDIERIDVDEGASGAMVGFNVHFHSLASASITAMF

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Evidence: [IHBCE] Inferred by a human based on computational evidence
Reference(s): [1] Serre L., et al., 2001
External database links:  
ECOCYC:
EG11238-MONOMER
ECOLIWIKI:
b0773
INTERPRO:
IPR036610
INTERPRO:
IPR008914
INTERPRO:
IPR005247
MODBASE:
P12994
PANTHER:
PTHR30289
PDB:
1FJJ
PDB:
1VI3
PFAM:
PF01161
PRIDE:
P12994
REFSEQ:
NP_415294
SMR:
P12994
UNIPROT:
P12994


Operon      
Name: ybhB         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_939 807309 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_940 (cluster) 807324 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter ybhBp4 807930 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ybhBp2 808035 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Serre L., Pereira de Jesus K., Zelwer C., Bureaud N., Schoentgen F., Benedetti H., 2001, Crystal structures of YBHB and YBCL from Escherichia coli, two bacterial homologues to a Raf kinase inhibitor protein., J Mol Biol 310(3):617-34

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB