RegulonDB RegulonDB 10.9: Gene Form
   

uspE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uspE fnr ynaJ ppGpp uspEp uspEp TSS_1758 TSS_1758

Gene      
Name: uspE    Texpresso search in the literature
Synonym(s): ECK1329, EG11246, b1333, ydaA
Genome position(nucleotides): 1397672 <-- 1398622 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.58
External database links:  
ASAP:
ABE-0004472
ECHOBASE:
EB1227
ECOLIHUB:
uspE
OU-MICROARRAY:
b1333
STRING:
511145.b1333
COLOMBOS: uspE


Product      
Name: universal stress protein E
Synonym(s): UspE, YdaA, universal stress protein with a role cellular motility
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 35.707
Isoelectric point: 4.991
Motif(s):
 
Type Positions Sequence
55 -> 55 D
59 -> 73 AMRQGVISQRTAWIH
2 -> 316 AMYQNMLVVIDPNQDDQPALRRAVYLHQRIGGKIKAFLPIYDFSYEMTTLLSPDERTAMRQGVISQRTAWIHEQAKYYLNAGVPIEIKVVWHNRPFEAIIQEVISGGHDLVLKMAHQHDRLEAVIFTPTDWHLLRKCPSPVWMVKDQPWPEGGKALVAVNLASEEPYHNALNEKLVKETIELAEQVNHTEVHLVGAYPVTPINIAIELPEFDPSVYNDAIRGQHLLAMKALRQKFGINENMTHVEKGLPEEVIPDLAEHLQAGIVVLGTVGRTGISAAFLGNTAEQVIDHLRCDLLVIKPDQYQTPVELDDEEDD
3 -> 146 MYQNMLVVIDPNQDDQPALRRAVYLHQRIGGKIKAFLPIYDFSYEMTTLLSPDERTAMRQGVISQRTAWIHEQAKYYLNAGVPIEIKVVWHNRPFEAIIQEVISGGHDLVLKMAHQHDRLEAVIFTPTDWHLLRKCPSPVWMVK
173 -> 300 NEKLVKETIELAEQVNHTEVHLVGAYPVTPINIAIELPEFDPSVYNDAIRGQHLLAMKALRQKFGINENMTHVEKGLPEEVIPDLAEHLQAGIVVLGTVGRTGISAAFLGNTAEQVIDHLRCDLLVIK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations
  5 - cell processes --> 5.6 - protection --> 5.6.1 - radiation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
biological_process GO:0006950 - response to stress
GO:0044010 - single-species biofilm formation
GO:0070301 - cellular response to hydrogen peroxide
GO:0034644 - cellular response to UV
GO:0071973 - bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Lu Q., et al., 2019
[2] Mahnic M., et al., 2012
[3] Nachin L., et al., 2005
External database links:  
DIP:
DIP-48118N
DISPROT:
DP00991
ECOCYC:
EG11246-MONOMER
ECOLIWIKI:
b1333
INTERPRO:
IPR006016
MINT:
P0AAC0
MODBASE:
P0AAC0
PDB:
5CB0
PFAM:
PF00582
PRIDE:
P0AAC0
PRODB:
PRO_000024194
REFSEQ:
NP_415849
SMR:
P0AAC0
UNIPROT:
P0AAC0


Operon      
Name: uspE         
Operon arrangement:
Transcription unit        Promoter
uspE


Transcriptional Regulation      
Display Regulation             
Activated by: GadX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1758 1398266 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Lu Q., Liu JZ., 2019, Enhanced Astaxanthin Production in Escherichia coli via Morphology and Oxidative Stress Engineering., J Agric Food Chem 67(42):11703-11709

 [2] Mahnic M., Baebler S., Blejec A., Jalen S., Gruden K., Menart V., Jevsevar S., 2012, Gene Expression Profiling of Recombinant Protein Producing E. coli at Suboptimal Growth Temperature., Acta Chim Slov 59(1):59-69

 [3] Nachin L., Nannmark U., Nystrom T., 2005, Differential roles of the universal stress proteins of Escherichia coli in oxidative stress resistance, adhesion, and motility., J Bacteriol 187(18):6265-72

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB