RegulonDB RegulonDB 10.8: Gene Form
   

mazF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

relA mazG mazF mazE Fis MazE-MazF MazE MazE MazE-MazF ppGpp terminator TSS_3086 TSS_3086 TSS_3085 TSS_3085 mazEp1 mazEp1 mazEp2 mazEp2 mazGp4 mazGp4

Gene      
Name: mazF    Texpresso search in the literature
Synonym(s): ECK2776, EG11249, b2782, chpA, chpAK
Genome position(nucleotides): 2910756 <-- 2911091 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.13
External database links:  
ASAP:
ABE-0009119
CGSC:
33287
ECHOBASE:
EB1229
OU-MICROARRAY:
b2782
PortEco:
chpA
STRING:
511145.b2782
COLOMBOS: mazF


Product      
Name: endoribonuclease toxin MazF
Synonym(s): ChpA, ChpAK, MazF, MazF toxin of the MazF-MazE toxin-antitoxin system that exhibits ribonuclease activity
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.098
Isoelectric point: 8.478
Motif(s):
 
Type Positions Sequence
10 -> 109 GDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVL
17 -> 28 FDPTKGSEQAGH
53 -> 61 TQSKGYPFE
24 -> 24 E
28 -> 28 H

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.4 - RNA degradation
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
  5 - cell processes --> 5.10 - defense/survival
  5 - cell processes --> 5.5 - adaptations --> 5.5.3 - starvation
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
  5 - cell processes --> 5.6 - protection --> 5.6.3 - cell killing
  5 - cell processes --> 5.6 - protection --> 5.6.4 - drug resistance/sensitivity
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032991 - protein-containing complex
molecular_function GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0004519 - endonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0004521 - endoribonuclease activity
GO:0042803 - protein homodimerization activity
GO:0044877 - protein-containing complex binding
biological_process GO:0043068 - positive regulation of programmed cell death
GO:0006417 - regulation of translation
GO:0009372 - quorum sensing
GO:0006402 - mRNA catabolic process
GO:0030308 - negative regulation of cell growth
GO:0016075 - rRNA catabolic process
GO:0051607 - defense response to virus
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
External database links:  
DISPROT:
DP00299
ECOCYC:
EG11249-MONOMER
ECOLIWIKI:
b2782
INTERPRO:
IPR011067
INTERPRO:
IPR003477
MODBASE:
P0AE70
PANTHER:
PTHR33988
PDB:
5CKD
PDB:
5CKE
PDB:
5CKF
PDB:
5CKH
PDB:
5CO7
PDB:
5CQX
PDB:
5CQY
PDB:
5CR2
PDB:
1UB4
PDB:
5CK9
PDB:
5CKB
PDB:
3NFC
PFAM:
PF02452
PRIDE:
P0AE70
PRODB:
PRO_000022284
REFSEQ:
NP_417262
SMR:
P0AE70
SWISSMODEL:
P0AE70
UNIPROT:
P0AE70


Operon      
Name: relA-mazEFG         
Operon arrangement:
Transcription unit        Promoter
mazEFG
mazEFG
relA
relA-mazEF
relA-mazEF
relA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, H-NS, Fis
Repressed by: HipAB, MazE, MazE-MazF, HipB
Growth Conditions:

[1] 

C: Escherichia coli| plasmid pALS13 (not induced truncated relA) mutant| LB medium| 37.0 C| mid exponential phase
E: Escherichia coli| plasmid pALS13 (IPTG-induced truncated relA) mutant| LB medium| 37.0 C| mid exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mazGp4 2910860 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3085 2913146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3086 2913158 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB