RegulonDB RegulonDB 10.7: Gene Form
   

ychA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdsA ychA ychQ prmC kdsAp kdsAp TSS_1548 TSS_1548 TSS_1547 (cluster) TSS_1547 (cluster)

Gene      
Name: ychA    Texpresso search in the literature
Synonym(s): ECK1202, EG11251, b1214, sirB1
Genome position(nucleotides): 1267320 --> 1268129 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.42
External database links:  
ASAP:
ABE-0004074
ECHOBASE:
EB1231
OU-MICROARRAY:
b1214
PORTECO:
ychA
REGULONDB:
b1214
STRING:
511145.b1214
M3D: ychA
COLOMBOS: ychA
PortEco: b1214


Product      
Name: transglutaminase-like/TPR repeat-containing protein
Synonym(s): YchA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.841
Isoelectric point: 4.202
Motif(s):
 
Type Positions Sequence
187 -> 259 LKASLMEENQMELALRTSEALLQFNPEDPYEIRDRGLIYAQLDCEHVALNDLSYFVEQCPEDPISEMIRAQIN
33 -> 184 DVYDELERLVSLAKEEISQLLPLEEQLEKLIALFYGDWGFKASRGVYRLSDALWLDQVLKNRQGSAVSLGAVLLWVANRLDLPLLPVIFPTQLILRIECPDGEIWLINPFNGESLSEHMLDVWLKGNISPSAELFYEDLDEADNIEVIRKLL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-35939N
ECOCYC:
EG11251-MONOMER
ECOLIWIKI:
b1214
INTERPRO:
IPR032698
PFAM:
PF13369
PRIDE:
P0AGM5
PRODB:
PRO_000023950
PROTEINMODELPORTAL:
P0AGM5
REFSEQ:
NP_415732
SMR:
P0AGM5
UNIPROT:
P0AGM5


Operon      
Name: ychQA-kdsA         
Operon arrangement:
Transcription unit        Promoter
ychQA-kdsA
kdsA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1547 (cluster) 1267181 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1548 1267190 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB