RegulonDB RegulonDB 10.9: Gene Form
   

ldtD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ldtD    Texpresso search in the literature
Synonym(s): ECK0916, EG11253, b0925, ycbB
Genome position(nucleotides): 981047 --> 982894 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.14
External database links:  
ASAP:
ABE-0003142
ECHOBASE:
EB1233
ECOLIHUB:
ycbB
OU-MICROARRAY:
b0925
STRING:
511145.b0925
COLOMBOS: ldtD


Product      
Name: L,D-transpeptidase LdtD
Synonym(s): LdtD, YcbB
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,inner membrane
Molecular weight: 67.812
Isoelectric point: 8.712
Motif(s):
 
Type Positions Sequence
268 -> 312 GPKITLPGDDTPTDAVVSPSAVTVETAETKPMDKQTTSRSKPAPA
315 -> 348 AAYDNELVEAVKRFQAWQGLGADGAIGPATRDWL
377 -> 543 IMVNIPAYSLVYYQNGNQVLDSRVIVGRPDRKTPMMSSALNNVVVNPPWNVPPTLARKDILPKVRNDPGYLESHGYTVMRGWNSREAIDPWQVDWSTITASNLPFRFQQAPGPRNSLGRYKFNMPSSEAIYLHDTPNHNLFKRDTRALSSGCVRVNKASDLANMLLQ
528 -> 528 C
426 -> 491 NVPPTLARKDILPKVRNDPGYLESHGYTVMRGWNSREAIDPWQVDWSTITASNLPFRFQQAPGPRN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0004180 - carboxypeptidase activity
GO:0016807 - cysteine-type carboxypeptidase activity
GO:0071972 - peptidoglycan L,D-transpeptidase activity
biological_process GO:0006508 - proteolysis
GO:0006974 - cellular response to DNA damage stimulus
GO:0009252 - peptidoglycan biosynthetic process
GO:0046677 - response to antibiotic
GO:0008360 - regulation of cell shape
GO:0018104 - peptidoglycan-protein cross-linking
GO:0071555 - cell wall organization
GO:0036460 - cellular response to cell envelope stress
Note(s): Note(s): ...[more].
Reference(s): [1] Hugonnet JE., et al., 2016
[2] Kuru E., et al., 2019
External database links:  
DIP:
DIP-11474N
ECOCYC:
EG11253-MONOMER
ECOLIWIKI:
b0925
INTERPRO:
IPR005490
INTERPRO:
IPR038063
INTERPRO:
IPR036365
INTERPRO:
IPR002477
MODBASE:
P22525
PDB:
6NTW
PFAM:
PF03734
PFAM:
PF01471
PRIDE:
P22525
PROSITE:
PS00092
REFSEQ:
NP_415445
SMR:
P22525
UNIPROT:
P22525


Operon      
Name: ldtD         
Operon arrangement:
Transcription unit        Promoter
ldtD


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1195 979917 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1196 980088 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1197 980108 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1198 983021 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1200 983050 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1201 983052 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1202 983510 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1203 (cluster) 983574 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1204 983579 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1205 983585 forward nd [RS-EPT-CBR] [3]



RegulonDB