RegulonDB RegulonDB 10.8: Gene Form
   

iraP gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phoA ddlA iraP PhoB DksA-ppGpp DksA-ppGpp ppGpp anti-terminator terminator anti-terminator anti-anti-terminator phoAp phoAp TSS_495 TSS_495 iraPp2 iraPp2 iraPp1 iraPp1

Gene      
Name: iraP    Texpresso search in the literature
Synonym(s): ECK0377, EG11256, b0382, yaiB
Genome position(nucleotides): 401386 --> 401646 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.36
External database links:  
ASAP:
ABE-0001313
ECHOBASE:
EB1236
OU-MICROARRAY:
b0382
PortEco:
iraP
STRING:
511145.b0382
COLOMBOS: iraP


Product      
Name: anti-adaptor protein for σS stabilization
Synonym(s): IraP, YaiB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 9.937
Isoelectric point: 4.546
Motif(s):
 
Type Positions Sequence
9 -> 9 L
1 -> 85 MKNLIAELLFKLAQKEEESKELCAQVEALEIIVTAMLRNMAQNDQQRLIDQVEGALYEVKPDASIPDDDTELLRDYVKKLLKHPR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  5 - cell processes --> 5.5 - adaptations
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0043856 - anti-sigma factor antagonist activity
biological_process GO:0045893 - positive regulation of transcription, DNA-templated
GO:0009267 - cellular response to starvation
GO:0016036 - cellular response to phosphate starvation
GO:0042177 - negative regulation of protein catabolic process
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IMP] Inferred from mutant phenotype
Reference(s): [1] Aubee JI., et al., 2016
[2] Bougdour A., et al., 2006
External database links:  
DIP:
DIP-48131N
ECOCYC:
EG11256-MONOMER
ECOLIWIKI:
b0382
INTERPRO:
IPR019732
PFAM:
PF10796
PRIDE:
P0AAN9
PRODB:
PRO_000023030
REFSEQ:
NP_414916
SMR:
P0AAN9
UNIPROT:
P0AAN9


Operon      
Name: iraP         
Operon arrangement:
Transcription unit        Promoter
iraP
iraP


Transcriptional Regulation      
Display Regulation             
Activated by: CsgD


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_495 401433 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Aubee JI., Olu M., Thompson KM., 2016, The i6A37 tRNA modification is essential for proper decoding of UUX-Leucine codons during rpoS and iraP translation., RNA 22(5):729-42

 [2] Bougdour A., Wickner S., Gottesman S., 2006, Modulating RssB activity: IraP, a novel regulator of sigma(S) stability in Escherichia coli., Genes Dev 20(7):884-97

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB