RegulonDB RegulonDB 10.7: Gene Form
   

focA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pflB ycaO focA FNR NarL NarL NarL NarL NarL ArcA NarL NarL NarL ArcA IHF NarL FNR CRP NarL NarL ArcA Fis anti-terminator terminator focAp3 focAp3 focAp2 focAp2 focAp1 focAp1 TSS_1168 TSS_1168 TSS_1167 (cluster) TSS_1167 (cluster) TSS_1166 (cluster) TSS_1166 (cluster) TSS_1165 TSS_1165 TSS_1164 TSS_1164 TSS_1163 TSS_1163 TSS_1162 TSS_1162 TSS_1161 TSS_1161 pflBp5 pflBp5 TSS_1160 TSS_1160 TSS_1159 TSS_1159 pflBp4 pflBp4 TSS_1158 (cluster) TSS_1158 (cluster) TSS_1157 TSS_1157 TSS_1156 (cluster) TSS_1156 (cluster) pflBp3 pflBp3 TSS_1155 TSS_1155 TSS_1154 TSS_1154 pflBp2 pflBp2 pflBp1 pflBp1 TSS_1151 TSS_1151 TSS_1150 TSS_1150 TSS_1149 TSS_1149 TSS_1148 TSS_1148 TSS_1147 TSS_1147 TSS_1146 TSS_1146 TSS_1145 TSS_1145 TSS_1144 (cluster) TSS_1144 (cluster) TSS_1143 TSS_1143 TSS_1142 (cluster) TSS_1142 (cluster) TSS_1141 TSS_1141 TSS_1140 TSS_1140 TSS_1139 TSS_1139 TSS_1138 (cluster) TSS_1138 (cluster) TSS_1137 TSS_1137 TSS_1136 TSS_1136 TSS_1135 TSS_1135 TSS_1134 TSS_1134 TSS_1133 TSS_1133 TSS_1132 (cluster) TSS_1132 (cluster) TSS_1131 TSS_1131 TSS_1130 TSS_1130 TSS_1129 TSS_1129 TSS_1128 TSS_1128 TSS_1127 TSS_1127 TSS_1126 TSS_1126 TSS_1125 TSS_1125 TSS_1124 (cluster) TSS_1124 (cluster) TSS_1123 TSS_1123 TSS_1122 TSS_1122 TSS_1121 TSS_1121 TSS_1120 TSS_1120 TSS_1119 TSS_1119 TSS_1118 TSS_1118 TSS_1117 (cluster) TSS_1117 (cluster) TSS_1116 (cluster) TSS_1116 (cluster) TSS_1115 (cluster) TSS_1115 (cluster) TSS_1114 TSS_1114 TSS_1113 TSS_1113 TSS_1112 TSS_1112 TSS_1111 (cluster) TSS_1111 (cluster) TSS_1110 TSS_1110 TSS_1109 TSS_1109 TSS_1108 TSS_1108 TSS_1107 TSS_1107 TSS_1106 TSS_1106 TSS_1105 (cluster) TSS_1105 (cluster) TSS_1104 TSS_1104

Gene      
Name: focA    Texpresso search in the literature
Synonym(s): ECK0895, EG11258, b0904, ycaE
Genome position(nucleotides): 953609 <-- 954466 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.95
Reference(s): [1] Sawers G., et al., 1989
External database links:  
ASAP:
ABE-0003073
CGSC:
31732
ECHOBASE:
EB1238
OU-MICROARRAY:
b0904
PORTECO:
focA
REGULONDB:
b0904
STRING:
511145.b0904
M3D: focA
COLOMBOS: focA
PortEco: b0904


Product      
Name: formate channel FocA
Synonym(s): FocA, YcaE
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 30.991
Isoelectric point: 6.942
Motif(s):
 
Type Positions Sequence
15 -> 276 MAKVAEEAGVYKATKHPLKTFYLAITAGVFISIAFVFYITATTGTGTMPFGMAKLVGGICFSLGLILCVVCGADLFTSTVLIVVAKASGRITWGQLAKNWLNVYFGNLVGALLFVLLMWLSGEYMTANGQWGLNVLQTADHKVHHTFIEAVCLGILANLMVCLAVWMSYSGRSLMDKAFIMVLPVAMFVASGFEHSIANMFMIPMGIVIRDFASPEFWTAVGSAPENFSHLTVMNFITDNLIPVTIGNIIGGGLLVGLTYWV
192 -> 207 AFIMVLPVAMFVASGF
260 -> 279 IGNIIGGGLLVGLTYWVIYL
69 -> 85 LVGGICFSLGLILCVVC
37 -> 53 LAITAGVFISIAFVFYI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0022857 - transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0015499 - formate transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
GO:0010447 - response to acidic pH
GO:0015724 - formate transport
GO:0019664 - mixed acid fermentation
External database links:  
DIP:
DIP-9670N
ECOCYC:
FOCA-MONOMER
ECOLIWIKI:
b0904
INTERPRO:
IPR023271
INTERPRO:
IPR000292
INTERPRO:
IPR023999
INTERPRO:
IPR024002
MINT:
MINT-1274847
PANTHER:
PTHR30520
PFAM:
PF01226
PRIDE:
P0AC23
PROSITE:
PS01006
PROSITE:
PS01005
PROTEINMODELPORTAL:
P0AC23
REFSEQ:
NP_415424
SMR:
P0AC23
UNIPROT:
P0AC23


Operon      
Name: focA-pflB         
Operon arrangement:
Transcription unit        Promoter
pflB
pflB
pflB
pflB
pflB
focA-pflB
focA-pflB
focA-pflB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, IHF, ArcA
Repressed by: NarL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1104 951504 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1105 (cluster) 951515 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1106 951822 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1107 951845 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1108 952063 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1109 952068 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1110 952083 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1111 (cluster) 952140 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1112 952158 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1113 952163 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1114 952167 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1115 (cluster) 952170 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1116 (cluster) 952183 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1117 (cluster) 952196 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1118 952199 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1119 952267 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1120 952271 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1121 952279 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1122 952397 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1123 952407 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1124 (cluster) 952421 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1125 952437 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1126 952443 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1127 952470 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1128 952479 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1129 952493 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1130 952584 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1131 952658 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1132 (cluster) 952666 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1133 952674 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1134 952677 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1135 953144 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1136 953146 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1137 953199 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1138 (cluster) 953225 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1139 953227 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1140 953229 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1141 953233 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1142 (cluster) 953251 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1143 953262 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1144 (cluster) 953311 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1145 953356 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1146 953449 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1147 953452 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1148 953454 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1149 953456 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1150 953537 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1151 953573 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1154 953645 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1155 953648 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1156 (cluster) 953745 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1157 953777 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1158 (cluster) 953824 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1159 953919 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1160 953922 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1161 954185 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1162 954226 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1163 954310 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1164 954317 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1165 954328 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1166 (cluster) 954442 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1167 (cluster) 954449 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1168 954492 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sawers G., Bock A., 1989, Novel transcriptional control of the pyruvate formate-lyase gene: upstream regulatory sequences and multiple promoters regulate anaerobic expression., J Bacteriol 171(5):2485-98

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB