RegulonDB RegulonDB 10.6.3: Gene Form
   

gspB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

gspA gspB rpsJ DksA-ppGpp DksA-ppGpp TSS_3833 TSS_3833 rpsJp rpsJp TSS_3832 TSS_3832 TSS_3831 TSS_3831 TSS_3830 TSS_3830 TSS_3829 TSS_3829 TSS_3828 TSS_3828 TSS_3827 TSS_3827 TSS_3826 TSS_3826 TSS_3825 (cluster) TSS_3825 (cluster) TSS_3824 (cluster) TSS_3824 (cluster) TSS_3823 (cluster) TSS_3823 (cluster) TSS_3822 TSS_3822 TSS_3821 TSS_3821 TSS_3820 (cluster) TSS_3820 (cluster) TSS_3819 TSS_3819

Gene      
Name: gspB    Texpresso search in the literature
Synonym(s): ECK3309, EG11263, b3322, pinO, pioO
Genome position(nucleotides): 3453508 <-- 3453927 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.95
External database links:  
ASAP:
ABE-0010865
ECHOBASE:
EB1243
ECOCYC:
EG11263
ECOLIHUB:
gspB
OU-MICROARRAY:
b3322
REGULONDB:
b3322
STRING:
511145.b3322
M3D: gspB
COLOMBOS: gspB
PortEco: b3322


Product      
Name: putative general secretion pathway protein B
Synonym(s): GspB, PinO, PioO, calcium-binding protein required for initiation of chromosome replication
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 15.876
Isoelectric point: 4.469
Motif(s):
 
Type Positions Sequence
1 -> 66 MFEFYIAAREQKETGHPGIFSRQKHSTIIYVICLLLICLWFAGMVLVGGYARQLWVLWIVKAEVTV
28 -> 48 IIYVICLLLICLWFAGMVLVG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Guzman EC., et al., 1991
External database links:  
ECOCYC:
EG11263-MONOMER
ECOLIWIKI:
b3322
PRIDE:
P03825
PRODB:
PRO_000023553
PROTEINMODELPORTAL:
P03825
REFSEQ:
NP_417781
UNIPROT:
P03825


Operon      
Name: gspAB         
Operon arrangement:
Transcription unit        Promoter
null
null
null
gspAB


Transcriptional Regulation      
Display Regulation             
Repressed by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3819 3453214 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3820 (cluster) 3453225 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3821 3453229 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3822 3453234 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3823 (cluster) 3453240 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3824 (cluster) 3453244 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3825 (cluster) 3453252 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3826 3453255 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3827 3453263 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3828 3453271 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3829 3453287 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3830 3453290 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3831 3453439 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3832 3453441 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3833 3453450 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Guzman EC., Jimenez-Sanchez A., 1991, Location of pinO, a new gene located between tufA and rpsJ, on the physical map of the Escherichia coli chromosome., J Bacteriol 173(23):7409

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB