RegulonDB RegulonDB 10.8: Gene Form
   

cmk gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpsA ycaL cmk IHF IHF IHF IHF IHF DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp anti-terminator anti-anti-terminator TSS_1187 (cluster) TSS_1187 (cluster) TSS_1186 (cluster) TSS_1186 (cluster) TSS_1185 (cluster) TSS_1185 (cluster) TSS_1184 TSS_1184 TSS_1183 TSS_1183 TSS_1182 (cluster) TSS_1182 (cluster) TSS_1181 TSS_1181 TSS_1180 TSS_1180 TSS_1179 (cluster) TSS_1179 (cluster) rpsAp3 rpsAp3 TSS_1178 TSS_1178 rpsAp1 rpsAp1 cmkp cmkp

Gene      
Name: cmk    Texpresso search in the literature
Synonym(s): ECK0901, EG11265, b0910, mssA, ycaF, ycaG
Genome position(nucleotides): 961201 --> 961884 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.65
External database links:  
ASAP:
ABE-0003101
CGSC:
31736
ECHOBASE:
EB1244
OU-MICROARRAY:
b0910
PortEco:
cmk
STRING:
511145.b0910
COLOMBOS: cmk


Product      
Name: cytidylate kinase
Synonym(s): Cmk, MssA, YcaF, YcaG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.746
Isoelectric point: 5.652
Motif(s):
 
Type Positions Sequence
164 -> 164 E
8 -> 221 ITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYAR
12 -> 20 GPSGAGKGT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.4 - pyrimidine ribonucleotide biosynthesis
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004127 - cytidylate kinase activity
biological_process GO:0010165 - response to X-ray
GO:0046940 - nucleoside monophosphate phosphorylation
GO:0006139 - nucleobase-containing compound metabolic process
GO:0006220 - pyrimidine nucleotide metabolic process
GO:0015949 - nucleobase-containing small molecule interconversion
GO:0016310 - phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Sargentini NJ., et al., 2016
External database links:  
ECOCYC:
CMPKI-MONOMER
ECOLIWIKI:
b0910
INTERPRO:
IPR003136
INTERPRO:
IPR011994
INTERPRO:
IPR027417
MODBASE:
P0A6I0
PANTHER:
PTHR21299:SF2
PDB:
2FEO
PDB:
2FEM
PDB:
1KDT
PDB:
1KDR
PDB:
1KDP
PDB:
1KDO
PDB:
1CKE
PDB:
2CMK
PFAM:
PF02224
PRIDE:
P0A6I0
PRODB:
PRO_000022301
REFSEQ:
NP_415430
SMR:
P0A6I0
UNIPROT:
P0A6I0


Operon      
Name: cmk-rpsA-ihfB         
Operon arrangement:
Transcription unit        Promoter
cmk-rpsA
rpsA-ihfB
rpsA-ihfB
ihfB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1178 961718 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1179 (cluster) 961893 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1180 961899 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1181 962373 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1182 (cluster) 962813 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1183 962831 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1184 962837 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1185 (cluster) 963236 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1186 (cluster) 963240 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1187 (cluster) 963362 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB