RegulonDB RegulonDB 10.8: Gene Form
   

fabZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lpxD lpxA fabZ TSS_379 TSS_379 TSS_378 TSS_378 TSS_377 TSS_377 TSS_376 TSS_376 TSS_375 TSS_375 TSS_374 TSS_374 TSS_373 (cluster) TSS_373 (cluster) TSS_372 (cluster) TSS_372 (cluster) TSS_371 (cluster) TSS_371 (cluster) TSS_370 (cluster) TSS_370 (cluster) TSS_369 (cluster) TSS_369 (cluster) TSS_368 TSS_368 TSS_367 TSS_367

Gene      
Name: fabZ    Texpresso search in the literature
Synonym(s): ECK0179, EG11284, b0180, sabA1, sefA, sfhC21, yaeA
Genome position(nucleotides): 202101 --> 202556 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.44
External database links:  
ASAP:
ABE-0000613
CGSC:
30597
ECHOBASE:
EB1261
OU-MICROARRAY:
b0180
PortEco:
fabZ
STRING:
511145.b0180
COLOMBOS: fabZ


Product      
Name: 3-hydroxy-acyl-[acyl-carrier-protein] dehydratase
Synonym(s): FabZ, SefA, YaeA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 17.033
Isoelectric point: 7.512
Motif(s):
 
Type Positions Sequence
85 -> 85 L
17 -> 141 LPHRFPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPIFPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKTRRGLTRFKGVALVDGKVVCEA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0008659 - (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase activity
GO:0004317 - 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity
GO:0016829 - lyase activity
GO:0016836 - hydro-lyase activity
GO:0008693 - 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase activity
GO:0019171 - 3-hydroxyacyl-[acyl-carrier-protein] dehydratase activity
GO:0042802 - identical protein binding
GO:0047451 - 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
biological_process GO:0006629 - lipid metabolic process
GO:0009245 - lipid A biosynthetic process
GO:0006633 - fatty acid biosynthetic process
External database links:  
DIP:
DIP-31868N
ECOCYC:
FABZ-MONOMER
ECOLIWIKI:
b0180
INTERPRO:
IPR013114
INTERPRO:
IPR029069
INTERPRO:
IPR010084
MINT:
MINT-1218564
MODBASE:
P0A6Q6
PDB:
6N3P
PFAM:
PF07977
PRIDE:
P0A6Q6
PRODB:
PRO_000022567
REFSEQ:
NP_414722
SMR:
P0A6Q6
SWISSMODEL:
P0A6Q6
UNIPROT:
P0A6Q6


Operon      
Name: bamA-skp-lpxD-fabZ-lpxAB-rnhB-dnaE         
Operon arrangement:
Transcription unit        Promoter
bamA-hlpA-lpxD-fabZ-lpxAB-rnhB-dnaE
bamA
hlpA-lpxD-fabZ-lpxA
lpxD
fabZ


Transcriptional Regulation      
Display Regulation             
Activated by: CpxR, GadE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_367 201749 forward nd [RS-EPT-CBR] [1]
  promoter TSS_368 201767 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_369 (cluster) 202019 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_370 (cluster) 202063 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_371 (cluster) 202070 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_372 (cluster) 202078 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_373 (cluster) 202081 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_374 202087 forward nd [RS-EPT-CBR] [1]
  promoter TSS_375 202110 forward nd [RS-EPT-CBR] [1]
  promoter TSS_376 202370 forward nd [RS-EPT-CBR] [1]
  promoter TSS_377 202372 forward nd [RS-EPT-CBR] [1]
  promoter TSS_378 202585 forward nd [RS-EPT-CBR] [1]
  promoter TSS_379 202645 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB