RegulonDB RegulonDB 10.7: Gene Form
   

ygbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mutS fhlA ygbA NsrR NsrR NsrR OxyS terminator mutSp mutSp ygbAp ygbAp

Gene      
Name: ygbA    Texpresso search in the literature
Synonym(s): ECK2727, EG11287, b2732
Genome position(nucleotides): 2856453 <-- 2856806 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.56
External database links:  
ASAP:
ABE-0008973
ECHOBASE:
EB1264
OU-MICROARRAY:
b2732
PORTECO:
ygbA
REGULONDB:
b2732
STRING:
511145.b2732
M3D: ygbA
COLOMBOS: ygbA
PortEco: b2732


Product      
Name: protein YgbA
Synonym(s): YgbA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 13.94
Isoelectric point: 9.984
Motif(s):
 
Type Positions Sequence
4 -> 106 KRISREKLTIKKMIDLYQAKCPQASAEPEHYEALFVYAQKRLDKCVFGEEKPACKQCPVHCYQPAKREEMKQIMRWAGPRMLWRHPILTVRHLIDDKRPVPEL

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
Reference(s): [1] Efromovich S., et al., 2008
External database links:  
ECOCYC:
EG11287-MONOMER
ECOLIWIKI:
b2732
INTERPRO:
IPR020483
PFAM:
PF11756
PRIDE:
P25728
PRODOM:
PD075772
PROTEINMODELPORTAL:
P25728
REFSEQ:
NP_417212
UNIPROT:
P25728


Operon      
Name: ygbA         
Operon arrangement:
Transcription unit        Promoter
ygbA


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR, FNR


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Efromovich S., Grainger D., Bodenmiller D., Spiro S., 2008, Genome-wide identification of binding sites for the nitric oxide-sensitive transcriptional regulator NsrR., Methods Enzymol 437:211-33


RegulonDB