RegulonDB RegulonDB 10.8: Gene Form
   

mak gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

araJ rdgC mak CRP makp4 makp4

Gene      
Name: mak    Texpresso search in the literature
Synonym(s): ECK0389, EG11288, b0394, yajF
Genome position(nucleotides): 410144 --> 411052 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.67
External database links:  
ASAP:
ABE-0001372
ECHOBASE:
EB1265
OU-MICROARRAY:
b0394
PortEco:
mak
STRING:
511145.b0394
COLOMBOS: mak


Product      
Name: fructokinase
Synonym(s): Mak, YajF, fructo(manno)kinase, manno(fructo)kinase
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 32.5
Isoelectric point: 5.41
Motif(s):
 
Type Positions Sequence
4 -> 11 GIDLGGTK
3 -> 301 IGIDLGGTKTEVIALGDAGEQLYRHRLPTPRDDYRQTIETIATLVDMAEQATGQRGTVGMGIPGSISPYTGVVKNANSTWLNGQPFDKDLSARLQREVRLANDANCLAVSEAVDGAAAGAQTVFAVIIGTGCGAGVAFNGRAHIGGNGTAGEWGHNPLPWMDEDELRYREEVPCYCGKQGCIETFISGTGFAMDYRRLSGHALKGSEIIRLVEESDPVAELALRRYELRLAKSLAHVVNILDPDVIVLGGGMSNVDRLYQTVGQLIKQFVFGGECETPVRKAKHGDSSGVRGAAWLWPQ
133 -> 140 GCGAGVAF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0019158 - mannokinase activity
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008865 - fructokinase activity
GO:0004396 - hexokinase activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0016310 - phosphorylation
GO:0046835 - carbohydrate phosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Kornberg H., et al., 2006
External database links:  
DIP:
DIP-11288N
ECOCYC:
EG11288-MONOMER
ECOLIWIKI:
b0394
INTERPRO:
IPR000600
MODBASE:
P23917
PANTHER:
PTHR18964
PFAM:
PF00480
PRIDE:
P23917
PRODB:
PRO_000023146
PROSITE:
PS01125
REFSEQ:
NP_414928
SMR:
P23917
UNIPROT:
P23917


Operon      
Name: mak         
Operon arrangement:
Transcription unit        Promoter
mak


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter makp4 410118 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kornberg H., Lourenco C., 2006, A route for fructose utilization by Escherichia coli involving the fucose regulon., Proc Natl Acad Sci U S A 103(51):19496-9

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB