RegulonDB RegulonDB 10.7: Gene Form
   

preA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

preT preA mglC yeiS CRP TSS_2455 TSS_2455 preTp preTp

Gene      
Name: preA    Texpresso search in the literature
Synonym(s): ECK2140, EG11289, b2147, yeiA
Genome position(nucleotides): 2235265 --> 2236500 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.05
External database links:  
ASAP:
ABE-0007098
ECHOBASE:
EB1266
MIM:
274270
OU-MICROARRAY:
b2147
PORTECO:
yeiA
REGULONDB:
b2147
STRING:
511145.b2147
M3D: preA
COLOMBOS: preA
PortEco: b2147


Product      
Name: NAD-dependent dihydropyrimidine dehydrogenase subunit PreA
Synonym(s): PreA, YeiA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.069
Isoelectric point: 5.181
Motif(s):
 
Type Positions Sequence
335 -> 367 VYPRINLDKCVGCGRCYISCYDGGHQAMEWSEK
134 -> 136 NFS
201 -> 202 NT
6 -> 304 LSITFCGVKFPNPFCLSSSPVGNCYEMCAKAYDTGWGGVVFKTIGFFIANEVSPRFDHLVKEDTGFIGFKNMEQIAEHPLEENLAALRRLKEDYPDKVLIASIMGENEQQWEELARLVQEAGADMIECNFSCPQMTSHAMGSDVGQSPELVEKYCRAVKRGSTLPMLAKMTPNIGDMCEVALAAKRGGADGIAAINTVKSITNIDLNQKIGMPIVNGKSSISGYSGKAVKPIALRFIQQMRTHPELRDFPISGIGGIETWEDAAEFLLLGAATLQVTTGIMQYGYRIVEDMASGLSHYL
369 -> 398 RTPHCNTEKCVGCLLCGHVCPVGCIELGEV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0017113 - dihydropyrimidine dehydrogenase (NADP+) activity
GO:0002058 - uracil binding
GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0003954 - NADH dehydrogenase activity
GO:0004159 - dihydrouracil dehydrogenase (NAD+) activity
GO:0050661 - NADP binding
biological_process GO:0008152 - metabolic process
GO:0006208 - pyrimidine nucleobase catabolic process
GO:0006928 - movement of cell or subcellular component
GO:0055114 - oxidation-reduction process
GO:0006212 - uracil catabolic process
GO:0006210 - thymine catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-11915N
ECOCYC:
EG11289-MONOMER
ECOLIWIKI:
b2147
INTERPRO:
IPR017900
INTERPRO:
IPR013785
INTERPRO:
IPR005720
INTERPRO:
IPR017896
MODBASE:
P25889
PFAM:
PF01180
PRIDE:
P25889
PROSITE:
PS51379
PROSITE:
PS00198
PROTEINMODELPORTAL:
P25889
REFSEQ:
NP_416652
SMR:
P25889
UNIPROT:
P25889


Operon      
Name: preTA         
Operon arrangement:
Transcription unit        Promoter
preTA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2455 2234353 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB