RegulonDB RegulonDB 10.8: Gene Form
   

yeiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yeiB galS folE GalS GalR CRP GalR GalS GalS GalR TSS_2456 TSS_2456 yeiBp2 yeiBp2 galSp galSp

Gene      
Name: yeiB    Texpresso search in the literature
Synonym(s): ECK2145, EG11290, b2152
Genome position(nucleotides): 2241810 <-- 2242967 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.4
External database links:  
ASAP:
ABE-0007115
ECHOBASE:
EB1267
OU-MICROARRAY:
b2152
PortEco:
yeiB
STRING:
511145.b2152
COLOMBOS: yeiB


Product      
Name: DUF418 domain-containing protein YeiB
Synonym(s): YeiB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 43.394
Isoelectric point: 10.335
Motif(s):
 
Type Positions Sequence
215 -> 374 LMRSGWLKGQFSLRHYRRTGFVLVAIGVTINLPAIALQWQLDWAYRWCAFLLQMPRELSAPFQAIGYASLFYGFWPQLSRFKLVLAIACVGRMALTNYLLQTLICTTLFYHLGLFMHFDRLELLAFVIPVWLANILFSVIWLRYFRQGPVEWLWRQLTLR
233 -> 253 TGFVLVAIGVTINLPAIALQW
50 -> 70 WAFLDLIGQVKFLTLFALLFG
132 -> 152 FNTGVMLYLVGLGVLLLLGLI
90 -> 110 LLVLLGFIHGLLFWDGDILLA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
EG11290-MONOMER
ECOLIWIKI:
b2152
INTERPRO:
IPR007349
PFAM:
PF04235
PRIDE:
P25747
REFSEQ:
NP_416657
UNIPROT:
P25747


Operon      
Name: folE-yeiB         
Operon arrangement:
Transcription unit        Promoter
folE-yeiB


Transcriptional Regulation      
Display Regulation             
Repressed by: MetJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yeiBp2 2243073 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_2456 2243404 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB