RegulonDB RegulonDB 10.7: Gene Form
   

ispE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

hemA prs ispE lolB FNR PurR anti-anti-terminator anti-terminator TSS_1544 (cluster) TSS_1544 (cluster) TSS_1543 (cluster) TSS_1543 (cluster) hemAp1 hemAp1 TSS_1542 TSS_1542 hemAp2 hemAp2 lolBp lolBp TSS_1541 (cluster) TSS_1541 (cluster) prsp prsp TSS_1540 TSS_1540 TSS_1539 TSS_1539 TSS_1538 TSS_1538

Gene      
Name: ispE    Texpresso search in the literature
Synonym(s): ECK1196, EG11294, b1208, ipk, ychB
Genome position(nucleotides): 1262026 <-- 1262877 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.4
External database links:  
ASAP:
ABE-0004056
ECHOBASE:
EB1271
OU-MICROARRAY:
b1208
PORTECO:
ispE
REGULONDB:
b1208
STRING:
511145.b1208
M3D: ispE
COLOMBOS: ispE
PortEco: b1208


Product      
Name: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Synonym(s): Ipk, IspE, YchB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 30.925
Isoelectric point: 4.914
Motif(s):
 
Type Positions Sequence
99 -> 109 PMGGGLGGGSS
239 -> 239 G
214 -> 263 IARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPE
92 -> 148 ISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRG
240 -> 240 T

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.11 - menaquinone, ubiquinone
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0050515 - 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity
biological_process GO:0008299 - isoprenoid biosynthetic process
GO:0016310 - phosphorylation
GO:0016114 - terpenoid biosynthetic process
GO:0019288 - isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway
External database links:  
DIP:
DIP-48028N
ECOCYC:
EG11294-MONOMER
ECOLIWIKI:
b1208
INTERPRO:
IPR036554
INTERPRO:
IPR014721
INTERPRO:
IPR020568
INTERPRO:
IPR004424
INTERPRO:
IPR006204
INTERPRO:
IPR013750
MODBASE:
P62615
PANTHER:
PTHR43527:SF2
PDB:
2WW4
PFAM:
PF00288
PFAM:
PF08544
PRIDE:
P62615
PRODB:
PRO_000023037
PROTEINMODELPORTAL:
P62615
REFSEQ:
NP_415726
SMR:
P62615
SWISSMODEL:
P62615
UNIPROT:
P62615


Operon      
Name: lolB-ispE-prs         
Operon arrangement:
Transcription unit        Promoter
prs
lolB-ispE-prs


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1538 1260982 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1539 1261162 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1540 1261821 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1541 (cluster) 1263536 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1542 1263675 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1543 (cluster) 1264894 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1544 (cluster) 1264899 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB