RegulonDB RegulonDB 10.8: Gene Form
   

purB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

purB phoP hflD PurR PhoP TSS_1475 TSS_1475 phoPp2 phoPp2 phoPp3 phoPp3 phoPp1 phoPp1 TSS_1474 (cluster) TSS_1474 (cluster) TSS_1473 TSS_1473 TSS_1472 TSS_1472 TSS_1471 TSS_1471 TSS_1470 TSS_1470 phoQp5 phoQp5

Gene      
Name: purB    Texpresso search in the literature
Synonym(s): ECK1117, EG11314, ade, ade(h), b1131
Genome position(nucleotides): 1190616 <-- 1191986 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.3
Reference(s): [1] Green SM., et al., 1996
[2] He B., et al., 1992
External database links:  
ASAP:
ABE-0003810
CGSC:
344
ECHOBASE:
EB1290
MIM:
103050
OU-MICROARRAY:
b1131
PortEco:
purB
STRING:
511145.b1131
COLOMBOS: purB


Product      
Name: adenylosuccinate lyase
Synonym(s): Ade, PurB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 51.543
Isoelectric point: 5.906
Motif(s):
 
Type Positions Sequence
14 -> 312 GRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADAIGYLDAIVASFSEEDAARIKTIERTTNHDVKAVEYFLKEKVAEIPELHAVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQLIDGIKDLAVQYRDIPLLSRTHGQPATPSTIGKEMANVAYRMERQYRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCVARFNTILIDFDRDVWGYIALNHFKQKTIAGEIGSSTMPHKVNPIDFENSEG
122 -> 123 TS
340 -> 344 STVLR
15 -> 16 RY
171 -> 171 H

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.2 - nucleotides --> 1.5.2.1 - purine biosynthesis
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0004018 - N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity
GO:0042802 - identical protein binding
GO:0070626 - (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate AMP-lyase (fumarate-forming) activity
biological_process GO:0006164 - purine nucleotide biosynthetic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0009152 - purine ribonucleotide biosynthetic process
GO:0006188 - IMP biosynthetic process
GO:0006189 - 'de novo' IMP biosynthetic process
GO:0044208 - 'de novo' AMP biosynthetic process
External database links:  
DIP:
DIP-10608N
ECOCYC:
ASL-MONOMER
ECOLIWIKI:
b1131
INTERPRO:
IPR008948
INTERPRO:
IPR024083
INTERPRO:
IPR022761
INTERPRO:
IPR020557
INTERPRO:
IPR013539
INTERPRO:
IPR004769
INTERPRO:
IPR000362
MINT:
MINT-1253735
MODBASE:
P0AB89
PANTHER:
PTHR11444
PDB:
2PTQ
PDB:
2PTR
PDB:
2PTS
PFAM:
PF00206
PFAM:
PF08328
PRIDE:
P0AB89
PRINTS:
PR00149
PRODB:
PRO_000024882
PROSITE:
PS00163
REFSEQ:
NP_415649
SMR:
P0AB89
UNIPROT:
P0AB89


Operon      
Name: hflD-purB         
Operon arrangement:
Transcription unit        Promoter
hflD-purB


Transcriptional Regulation      
Display Regulation             
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1470 1189968 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1471 1190330 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1472 1190342 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1473 1190470 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1474 (cluster) 1190474 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_1475 1192505 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Green SM., Malik T., Giles IG., Drabble WT., 1996, The purB gene of Escherichia coli K-12 is located in an operon., Microbiology 142 ( Pt 11):3219-30

 [2] He B., Smith JM., Zalkin H., 1992, Escherichia coli purB gene: cloning, nucleotide sequence, and regulation by purR., J Bacteriol 174(1):130-6

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB