RegulonDB RegulonDB 10.8: Gene Form
   

fabG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fabD fabG acpP anti-terminator anti-anti-terminator terminator TSS_1415 (cluster) TSS_1415 (cluster) TSS_1414 TSS_1414 TSS_1413 (cluster) TSS_1413 (cluster) TSS_1412 TSS_1412 TSS_1411 TSS_1411 TSS_1410 TSS_1410 TSS_1409 TSS_1409 TSS_1408 TSS_1408 acpPp acpPp TSS_1407 (cluster) TSS_1407 (cluster) TSS_1406 (cluster) TSS_1406 (cluster) TSS_1405 (cluster) TSS_1405 (cluster) TSS_1404 TSS_1404 TSS_1403 (cluster) TSS_1403 (cluster) TSS_1402 TSS_1402 TSS_1401 TSS_1401 TSS_1400 TSS_1400 TSS_1399 TSS_1399 TSS_1398 TSS_1398 TSS_1397 TSS_1397 TSS_1396 TSS_1396 TSS_1395 TSS_1395 TSS_1394 TSS_1394 TSS_1393 TSS_1393

Gene      
Name: fabG    Texpresso search in the literature
Synonym(s): ECK1079, EG11318, b1093
Genome position(nucleotides): 1150670 --> 1151404 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.56
External database links:  
ASAP:
ABE-0003700
ECHOBASE:
EB1294
OU-MICROARRAY:
b1093
PortEco:
fabG
STRING:
511145.b1093
COLOMBOS: fabG


Product      
Name: 3-oxoacyl-[acyl-carrier-protein] reductase FabG
Synonym(s): 3-oxoacyl-[acyl-carrier-protein] reductase subunit, FabG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 25.56
Isoelectric point: 7.673
Motif(s):
 
Type Positions Sequence
12 -> 241 GASRGIGRAIAETLAARGAKVIGTATSENGAQAISDYLGANGKGLMLNVTDPASIESVLEKIRAEFGEVDILVNNAGITRDNLLMRMKDEEWNDIIETNLSSVFRLSKAVMRAMMKKRHGRIITIGSVVGTMGNGGQANYAAAKAGLIGFSKSLAREVASRGITVNVVAPGFIETDMTRALSDDQRAGILAQVPAGRLGGAQEIANAVAFLASDEAAYITGETLHVNGGM
43 -> 43 Q
233 -> 233 E
30 -> 30 A
59 -> 60 NV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.4 - fatty acids and phosphatidic acid
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0102131 - 3-oxo-glutaryl-[acp] methyl ester reductase activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0004316 - 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
GO:0042802 - identical protein binding
GO:0050661 - NADP binding
GO:0051287 - NAD binding
GO:0102132 - 3-oxo-pimeloyl-[acp] methyl ester reductase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006631 - fatty acid metabolic process
GO:0008610 - lipid biosynthetic process
GO:0009102 - biotin biosynthetic process
GO:0006633 - fatty acid biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0030497 - fatty acid elongation
External database links:  
DIP:
DIP-31869N
ECOCYC:
3-OXOACYL-ACP-REDUCT-MONOMER
ECOLIWIKI:
b1093
INTERPRO:
IPR002347
INTERPRO:
IPR036291
INTERPRO:
IPR020904
INTERPRO:
IPR011284
MINT:
MINT-1232516
MODBASE:
P0AEK2
PANTHER:
PTHR24322
PDB:
1Q7B
PDB:
1Q7C
PDB:
1I01
PFAM:
PF13561
PRIDE:
P0AEK2
PRINTS:
PR00080
PRINTS:
PR00081
PRODB:
PRO_000022563
PROSITE:
PS00061
REFSEQ:
NP_415611
SMR:
P0AEK2
SWISSMODEL:
P0AEK2
UNIPROT:
P0AEK2


Operon      
Name: yceD-rpmF-plsX-fabHDG-acpP-fabF         
Operon arrangement:
Transcription unit        Promoter
yceD-rpmF
yceD-rpmF
rpmF-plsX-fabHDG
plsX-fabHDG
fabHDG
acpP
acpP-fabF
fabDG-acpP
fabF
fabG-acpP


Transcriptional Regulation      
Display Regulation             
Activated by: FadR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1393 1150045 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1394 1150372 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1395 1150404 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1396 1150416 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1397 1150443 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1398 1150491 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1399 1150589 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1400 1150957 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1401 1151080 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1402 1151229 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1403 (cluster) 1151352 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1404 1151355 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1405 (cluster) 1151357 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1406 (cluster) 1151510 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1407 (cluster) 1151558 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1408 1151576 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1409 1151598 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1410 1151645 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1411 1151715 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1412 1151724 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1413 (cluster) 1151764 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1414 1151773 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1415 (cluster) 1151777 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB