RegulonDB RegulonDB 10.9: Gene Form
   

acnA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

acnA ribA ymiC ArcA FNR CRP SoxS Rob MarA acnAp3 acnAp3 acnAp2 acnAp2

Gene      
Name: acnA    Texpresso search in the literature
Synonym(s): ECK1271, EG11325, acn, b1276
Genome position(nucleotides): 1335831 --> 1338506 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.91
External database links:  
ASAP:
ABE-0004283
CGSC:
28218
ECHOBASE:
EB1301
ECOLIHUB:
acnA
OU-MICROARRAY:
b1276
STRING:
511145.b1276
COLOMBOS: acnA


Product      
Name: aconitate hydratase 1
Synonym(s): Acn, AcnA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 97.677
Isoelectric point: 5.677
Motif(s):
 
Type Positions Sequence
2 -> 891 SSTLREASKDTLQAKDKTYHYYSLPLAAKSLGDITRLPKSLKVLLENLLRWQDGNSVTEEDIHALAGWLKNAHADREIAYRPARVLMQDFTGVPAVVDLAAMREAVKRLGGDTAKVNPLSPVDLVIDHSVTVDRFGDDEAFEENVRLEMERNHERYVFLKWGKQAFSRFSVVPPGTGICHQVNLEYLGKAVWSELQDGEWIAYPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQPVSMLIPDVVGFKLTGKLREGITATDLVLTVTQMLRKHGVVGKFVEFYGDGLDSLPLADRATIANMSPEYGATCGFFPIDAVTLDYMRLSGRSEDQVELVEKYAKAQGMWRNPGDEPIFTSTLELDMNDVEASLAGPKRPQDRVALPDVPKAFAASNELEVNATHKDRQPVDYVMNGHQYQLPDGAVVIAAITSCTNTSNPSVLMAAGLLAKKAVTLGLKRQPWVKASLAPGSKVVSDYLAKAKLTPYLDELGFNLVGYGCTTCIGNSGPLPDPIETAIKKSDLTVGAVLSGNRNFEGRIHPLVKTNWLASPPLVVAYALAGNMNINLASEPIGHDRKGDPVYLKDIWPSAQEIARAVEQVSTEMFRKEYAEVFEGTAEWKGINVTRSDTYGWQEDSTYIRLSPFFDEMQATPAPVEDIHGARILAMLGDSVTTDHISPAGSIKPDSPAGRYLQGRGVERKDFNSYGSRRGNHEVMMRGTFANIRIRNEMVPGVEGGMTRHLPDSDVVSIYDAAMRYKQEQTPLAVIAGKEYGSGSSRDWAAKGPRLLGIRVVIAESFERIHRSNLIGMGILPLEFPQGVTRKTLGLTGEEKIDIGDLQNLQPGATVPVTLTRADGSQEVVPCRCRIDTATELTYYQNDGILHYVIRNMLK
69 -> 562 WLKNAHADREIAYRPARVLMQDFTGVPAVVDLAAMREAVKRLGGDTAKVNPLSPVDLVIDHSVTVDRFGDDEAFEENVRLEMERNHERYVFLKWGKQAFSRFSVVPPGTGICHQVNLEYLGKAVWSELQDGEWIAYPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQPVSMLIPDVVGFKLTGKLREGITATDLVLTVTQMLRKHGVVGKFVEFYGDGLDSLPLADRATIANMSPEYGATCGFFPIDAVTLDYMRLSGRSEDQVELVEKYAKAQGMWRNPGDEPIFTSTLELDMNDVEASLAGPKRPQDRVALPDVPKAFAASNELEVNATHKDRQPVDYVMNGHQYQLPDGAVVIAAITSCTNTSNPSVLMAAGLLAKKAVTLGLKRQPWVKASLAPGSKVVSDYLAKAKLTPYLDELGFNLVGYGCTTCIGNSGPLPDPIETAIKKSDLTVGAVLSGNRNFEGRIHPLVKTNWLASPPLVVAYALAG
522 -> 522 S
691 -> 818 RYLQGRGVERKDFNSYGSRRGNHEVMMRGTFANIRIRNEMVPGVEGGMTRHLPDSDVVSIYDAAMRYKQEQTPLAVIAGKEYGSGSSRDWAAKGPRLLGIRVVIAESFERIHRSNLIGMGILPLEFPQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.4 - TCA cycle
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional
  5 - cell processes --> 5.5 - adaptations --> 5.5.6 - other (mechanical, nutritional, oxidative stress)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0047780 - citrate dehydratase activity
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0003723 - RNA binding
GO:0003729 - mRNA binding
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0003994 - aconitate hydratase activity
GO:0005506 - iron ion binding
GO:0003730 - mRNA 3'-UTR binding
biological_process GO:0006097 - glyoxylate cycle
GO:0006099 - tricarboxylic acid cycle
GO:0006979 - response to oxidative stress
GO:0009061 - anaerobic respiration
GO:0006101 - citrate metabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Prodromou C., et al., 1992
[2] Prodromou C., et al., 1991
External database links:  
DIP:
DIP-9043N
ECOCYC:
ACONITASE-MONOMER
ECOLIWIKI:
b1276
INTERPRO:
IPR015928
INTERPRO:
IPR018136
INTERPRO:
IPR000573
INTERPRO:
IPR001030
INTERPRO:
IPR006249
INTERPRO:
IPR015931
INTERPRO:
IPR036008
MODBASE:
P25516
PANTHER:
PTHR11670
PFAM:
PF00330
PFAM:
PF00694
PRIDE:
P25516
PRINTS:
PR00415
PRODB:
PRO_000022042
PROSITE:
PS01244
PROSITE:
PS00450
REFSEQ:
NP_415792
SMR:
P25516
UNIPROT:
P25516


Operon      
Name: ymiC-acnA         
Operon arrangement:
Transcription unit        Promoter
acnA
acnA
acnA
acnA


Transcriptional Regulation      
Display Regulation             
Activated by: MarA, CRP, Cra, Rob, SoxS
Repressed by: FNR, ArcA
Growth Conditions:

[1] 

C: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSE380 mutant| LB medium| paraquat 50 µM| 37.0 C
E: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSXS (IPTG-induced soxS) mutant| LB medium| paraquat 50 µM| 37.0 C

[2] 

C: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSXR (IPTG-induced soxR) mutant| LB medium| 37.0 C
E: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSXR (IPTG-induced soxR) mutant| LB medium| paraquat 50 µM| 37.0 C

[3] 

C: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSE380 mutant| LB medium| 2,2'-bipyridine 150 ?m| 37.0 C
E: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSXR (IPTG-induced soxR) mutant| LB medium| 2,2'-bipyridine 150 ?m| 37.0 C

[4] 

C: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSE380 mutant| LB medium| 2,2'-bipyridine 150 ?m| 37.0 C
E: Escherichia coli| soxR knockout mutant; soxS knockout mutant; plasmid pSXS (IPTG-induced soxS) mutant| LB medium| 2,2'-bipyridine 150 ?m| 37.0 C



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Prodromou C., Artymiuk PJ., Guest JR., 1992, The aconitase of Escherichia coli. Nucleotide sequence of the aconitase gene and amino acid sequence similarity with mitochondrial aconitases, the iron-responsive-element-binding protein and isopropylmalate isomerases., Eur J Biochem 204(2):599-609

 [2] Prodromou C., Haynes MJ., Guest JR., 1991, The aconitase of Escherichia coli: purification of the enzyme and molecular cloning and map location of the gene (acn)., J Gen Microbiol 137(11):2505-15


RegulonDB