RegulonDB RegulonDB 10.8: Gene Form
   

codB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

prpE codA codB cynR PurR Nac codBp codBp

Gene      
Name: codB    Texpresso search in the literature
Synonym(s): ECK0333, EG11327, b0336
Genome position(nucleotides): 354922 --> 356181 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
External database links:  
ASAP:
ABE-0001159
CGSC:
912
ECHOBASE:
EB1303
OU-MICROARRAY:
b0336
PortEco:
codB
STRING:
511145.b0336
COLOMBOS: codB


Product      
Name: cytosine transporter
Synonym(s): CodB, CodB cytosine NCS1 transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 43.65
Isoelectric point: 9.297
Motif(s):
 
Type Positions Sequence
11 -> 397 PVPQSARKGVLALTFVMLGLTFFSASMWTGGTLGTGLSYHDFFLAVLIGNLLLGIYTSFLGYIGAKTGLTTHLLARFSFGVKGSWLPSLLLGGTQVGWFGVGVAMFAIPVGKATGLDINLLIAVSGLLMTVTVFFGISALTVLSVIAVPAIACLGGYSVWLAVNGMGGLDALKAVVPAQPLDFNVALALVVGSFISAGTLTADFVRFGRNAKLAVLVAMVAFFLGNSLMFIFGAAGAAALGMADISDVMIAQGLLLPAIVVLGLNIWTTNDNALYASGLGFANITGMSSKTLSVINGIIGTVCALWLYNNFVGWLTFLSAAIPPVGGVIIADYLMNRRRYEHFATTRMMSVNWVAILAVALGIAAGHWLPGIVPVNAVLGGALSYLI
20 -> 39 VLALTFVMLGLTFFSASMWT
101 -> 120 LGGTQVGWFGVGVAMFAIPV
322 -> 341 VGWLTFLSAAIPPVGGVIIA
128 -> 147 INLLIAVSGLLMTVTVFFGI

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015295 - solute:proton symporter activity
GO:0022857 - transmembrane transporter activity
GO:0015209 - cytosine transmembrane transporter activity
biological_process GO:0019858 - cytosine metabolic process
GO:0055085 - transmembrane transport
GO:0015856 - cytosine transport
GO:1902600 - proton transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
CODB-MONOMER
ECOLIWIKI:
b0336
INTERPRO:
IPR030191
INTERPRO:
IPR038271
INTERPRO:
IPR001248
PANTHER:
PTHR30569
PFAM:
PF02133
PRIDE:
P0AA82
PRODB:
PRO_000022317
REFSEQ:
NP_414870
SMR:
P0AA82
UNIPROT:
P0AA82


Operon      
Name: codBA         
Operon arrangement:
Transcription unit        Promoter
codBA


Transcriptional Regulation      
Display Regulation             
Activated by: Nac
Repressed by: PurR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB